rpmA
- Type
- protein_coding
- Name
- rpmA
- Locus Name
-
Rv2441c
- Product
-
50S ribosomal protein L27 RpmA
- Functional Category
-
Information pathways
- Location
- 2739772..2740032 (- strand)
- Gene Length
- 260 bp
- Nucleotides
-
ATGGCACACAAGAAGGGGGCTTCCAGCTCGCGCAACGGTCGCGATTCCGCCGCCCAGCGGCTGGGGGTTAAGCGGTACGGCGGCCAGGTCGTCAAGGCCGGCGAGATCCTGGTCCGCCAGCGCGGTACCAAATTCCATCCCGGCGTCAACGTCGGGCGTGGCGGCGATGACACCTTGTTCGCCAAGACGGCCGGGGCGGTCGAGTTCGGCATCAAACGCGGACGTAAGACGGTGAGCATCGTCGGTTCGACCACTGCCTG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Bacterial ribosomal protein bL27 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- cell wall GO:0005618 cellular_component
- plasma membrane GO:0005886 cellular_component
- translation GO:0006412 biological_process
- InterPro
5V7Q
- Name
- 50S ribosomal protein L27
- Family
- Bacterial ribosomal protein bL27 family
- Protein Sequence
-
MAHKKGASSSRNGRDSAAQRLGVKRYGGQVVKAGEILVRQRGTKFHPGVNVGRGGDDTLFAKTAGAVEFGIKRGRKTVSIVGSTTA
- Mass
- 8,968 Da
- Length
- 86 Aa
Summary
Rv2441c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.