rpfE
- Type
- protein_coding
- Name
- rpfE
- Locus Name
-
Rv2450c
- Product
-
Probable resuscitation-promoting factor RpfE
- Functional Category
-
Cell wall and cell processes
- Location
- 2751662..2752180 (- strand)
- Gene Length
- 518 bp
- Nucleotides
-
TTGAAGAACGCCCGTACGACGCTCATCGCCGCCGCGATTGCCGGGACGTTGGTGACCACGTCACCAGCCGGTATCGCCAATGCCGACGACGCGGGCTTGGACCCAAACGCCGCAGCCGGCCCGGATGCCGTGGGCTTTGACCCGAACCTGCCGCCGGCCCCGGACGCTGCACCCGTCGATACTCCGCCGGCTCCGGAGGACGCGGGCTTTGATCCCAACCTCCCCCCGCCGCTGGCCCCGGACTTCCTGTCCCCGCCTGCGGAGGAAGCGCCTCCCGTGCCCGTGGCCTACAGCGTGAACTGGGACGCGATCGCGCAGTGCGAGTCCGGTGGAAACTGGTCGATCAACACCGGTAACGGTTACTACGGCGGCCTGCGGTTCACCGCCGGCACCTGGCGTGCCAACGGTGGCTCGGGGTCCGCGGCCAACGCGAGCCGGGAGGAGCAGATCCGGGTGGCTGAGAACGTGCTGCGTTCGCAGGGTATCCGCGCCTGGCCGGTCTGCGGCCGCCGCGGCTG
- Drug Resistance
- Mutations
- Function
- Factor that stimulates resuscitation of dormant cells. Has peptidoglycan (PG) hydrolytic activity. Active in the pM concentration range. Has little to no effect on actively-growing cells. PG fragments could either directly activate the resuscitation pathway of dormant bacteria or serve as a substrate for endogenous Rpf, resulting in low molecular weight products with resuscitation activity. {ECO:0000269|PubMed:12410821}.; FUNCTION: Stimulates growth of stationary phase M.bovis (a slow-growing Mycobacterium), reduces the lag phase of diluted fast-growers M.smegmatis and Micrococcus luteus. Sequential gene disruption indicates RpfB and RpfE are higher than RpfD and RpfC in functional hierarchy. {ECO:0000269|PubMed:12410821}.
- Family
-
Transglycosylase family, Rpf subfamily
- GO
-
- positive regulation of gene expression GO:0010628 biological_process
- negative regulation of gene expression GO:0010629 biological_process
- pathogenesis GO:0009405 biological_process
- positive regulation of growth rate GO:0040010 biological_process
- extracellular region GO:0005576 cellular_component
- hydrolase activity GO:0016787 molecular_function
- InterPro
4CGE
- Name
- Resuscitation-promoting factor RpfE (EC 3.-.-.-)
- Family
- Transglycosylase family, Rpf subfamily
- Protein Sequence
-
MKNARTTLIAAAIAGTLVTTSPAGIANADDAGLDPNAAAGPDAVGFDPNLPPAPDAAPVDTPPAPEDAGFDPNLPPPLAPDFLSPPAEEAPPVPVAYSVNWDAIAQCESGGNWSINTGNGYYGGLRFTAGTWRANGGSGSAANASREEQIRVAENVLRSQGIRAWPVCGRRG
- Mass
- 17,456 Da
- Length
- 172 Aa
Summary
Rv2450c doesn't seem to be a targeted by any drug.
Rv2450c doesn't seem to be involved in any pathway.
- The resuscitation-promoting factors of Mycobacterium tuberculosis are required for virulence and resuscitation from dormancy but are collectively dispensable for growth in vitro.
- Mol Microbiol. 2008 Feb;67(3):672-84. doi: 10.1111/j.1365-2958.2007.06078.x.
- A partner for the resuscitation-promoting factors of Mycobacterium tuberculosis.
- Mol Microbiol. 2007 Nov;66(3):658-68. doi: 10.1111/j.1365-2958.2007.05945.x. Epub 2007 Oct 4.
- Global expression profiling of strains harbouring null mutations reveals that the five rpf-like genes of Mycobacterium tuberculosis show functional redundancy.
- Tuberculosis (Edinb). 2004;84(3-4):167-79. doi: 10.1016/j.tube.2003.12.004.
- Proteins of the Rpf family: immune cell reactivity and vaccination efficacy against tuberculosis in mice.
- Infect Immun. 2003 Aug;71(8):4789-94. doi: 10.1128/iai.71.8.4789-4794.2003.
- A family of autocrine growth factors in Mycobacterium tuberculosis.
- Mol Microbiol. 2002 Nov;46(3):623-35.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.