clpP2
- Type
- protein_coding
- Name
- clpP2
- Locus Name
-
Rv2460c
- Product
-
Probable ATP-dependent CLP protease proteolytic subunit 2 ClpP2 (endopeptidase CLP 2)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 2762531..2763175 (- strand)
- Gene Length
- 644 bp
- Nucleotides
-
GTGAATTCCCAAAATTCTCAGATCCAGCCCCAGGCGCGCTACATCCTGCCGTCGTTCATCGAGCACTCCAGCTTCGGGGTCAAGGAGTCCAATCCATACAACAAGCTGTTCGAGGAACGCATCATCTTCCTCGGCGTCCAGGTCGACGACGCGTCGGCGAACGACATCATGGCACAGTTGCTGGTGTTGGAGTCGTTGGATCCCGACCGCGATATCACCATGTACATCAACTCGCCGGGCGGTGGGTTCACCTCGCTGATGGCGATCTACGACACCATGCAATACGTGCGGGCCGATATCCAGACGGTGTGTCTGGGCCAGGCCGCCTCGGCGGCTGCGGTGCTGCTGGCCGCCGGAACACCGGGCAAGCGCATGGCGCTGCCGAATGCGCGGGTGTTGATCCATCAGCCGTCGTTGTCGGGCGTGATCCAGGGACAGTTCTCCGATCTGGAGATCCAGGCCGCCGAGATCGAGCGGATGCGCACCCTGATGGAAACCACGCTGGCCCGCCACACCGGCAAGGACGCCGGAGTGATCCGCAAAGACACTGACCGGGACAAGATCTTGACCGCGGAAGAGGCTAAGGACTACGGCATCATCGACACGGTGCTCGAGTACCGGAAGCTCTCCGCGCAAACCGCCTG
- Drug Resistance
- Mutations
- Function
- Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins (By similarity). Degrades anti-sigma-D factor RsdA when present in a complex with ClpP1 and ClpX. Degrades anti-sigma-E factor RseA in the presence of ClpC1. Does not seem to act on anti-sigma-L factor RslA. {ECO:0000255|HAMAP-Rule:MF_00444, ECO:0000269|PubMed:20025669, ECO:0000269|PubMed:23314154}.
- Family
-
Peptidase S14 family
- GO
-
- endopeptidase Clp complex GO:0009368 cellular_component
- cell wall GO:0005618 cellular_component
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- ATP-dependent peptidase activity GO:0004176 molecular_function
- protein quality control for misfolded or incompletely synthesized proteins GO:0006515 biological_process
- ATPase binding GO:0051117 molecular_function
- serine-type endopeptidase activity GO:0004252 molecular_function
- InterPro
4U0G
- Name
- ATP-dependent Clp protease proteolytic subunit 2 (EC 3.4.21.92) (Endopeptidase Clp 2)
- Family
- Peptidase S14 family
- Protein Sequence
-
MNSQNSQIQPQARYILPSFIEHSSFGVKESNPYNKLFEERIIFLGVQVDDASANDIMAQLLVLESLDPDRDITMYINSPGGGFTSLMAIYDTMQYVRADIQTVCLGQAASAAAVLLAAGTPGKRMALPNARVLIHQPSLSGVIQGQFSDLEIQAAEIERMRTLMETTLARHTGKDAGVIRKDTDRDKILTAEEAKDYGIIDTVLEYRKLSAQTA
- Mass
- 23,540 Da
- Length
- 214 Aa
Summary
Rv2460c doesn't seem to be a targeted by any drug.
Rv2460c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis RsdA provides a conformational rationale for selective regulation of sigma-factor activity by proteolysis.
- Nucleic Acids Res. 2013 Mar 1;41(5):3414-23. doi: 10.1093/nar/gks1468. Epub 2013 Jan 11.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- RseA, the SigE specific anti-sigma factor of Mycobacterium tuberculosis, is inactivated by phosphorylation-dependent ClpC1P2 proteolysis.
- Mol Microbiol. 2010 Feb;75(3):592-606. doi: 10.1111/j.1365-2958.2009.07008.x. Epub 2009 Dec 16.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.