glbO
- Type
- protein_coding
- Name
- glbO
- Locus Name
-
Rv2470
- Product
-
Globin (oxygen-binding protein) GlbO
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 2773178..2773564 (+ strand)
- Gene Length
- 386 bp
- Nucleotides
-
TGCCGAAGTCTTTCTACGACGCGGTCGGCGGCGCCAAAACCTTCGACGCGATCGTGTCGCGTTTCTATGCGCAGGTCGCCGAGGACGAAGTACTGCGGCGGGTGTACCCCGAAGATGACTTAGCCGGCGCCGAGGAACGATTGCGGATGTTCCTCGAGCAGTACTGGGGCGGCCCACGAACCTACTCGGAGCAGCGCGGCCACCCCCGATTGCGGATGCGGCATGCCCCGTTTCGGATCTCGCTCATCGAACGCGACGCCTGGCTGCGGTGCATGCATACGGCTGTGGCCTCCATCGACTCAGAAACGCTCGATGACGAGCACCGTCGAGAGTTGCTGGATTATCTGGAGATGGCCGCTCACTCGCTGGTCAACTCCCCGTTTTGA
- Drug Resistance
- Mutations
- Function
- When expressed in E.coli and M.smegmatis, HbO increases oxygen uptake. Membrane vesicles of E.coli carrying HbO show a respiration activity about twice that of membranes without HbO. HbO seems to interact with a terminal oxidase. Therefore, HbO could participate in oxygen/electron-transfer process, suggesting a function related to the facilitation of oxygen transfer during aerobic metabolism of M.tuberculosis.
- Family
-
Truncated hemoglobin family, Group II subfamily
- GO
-
- metal ion binding GO:0046872 molecular_function
- heme binding GO:0020037 molecular_function
- oxygen carrier activity GO:0005344 molecular_function
- oxygen binding GO:0019825 molecular_function
- oxygen transport GO:0015671 biological_process
- plasma membrane GO:0005886 cellular_component
- oxidation-reduction process GO:0055114 biological_process
- InterPro
1NGK
- Name
- Group 2 truncated hemoglobin GlbO (Hemoglobin-like protein HbO) (Truncated hemoglobin) (trHbO)
- Family
- Truncated hemoglobin family, Group II subfamily
- Protein Sequence
-
MPKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRRELLDYLEMAAHSLVNSPF
- Mass
- 14,950 Da
- Length
- 128 Aa
Summary
Rv2470 doesn't seem to be a targeted by any drug.
Rv2470 doesn't seem to be involved in any pathway.
- A TyrCD1/TrpG8 hydrogen bond network and a TyrB10TyrCD1 covalent link shape the heme distal site of Mycobacterium tuberculosis hemoglobin O.
- Proc Natl Acad Sci U S A. 2003 May 13;100(10):5766-71. doi: 10.1073/pnas.1037676100. Epub 2003 Apr 28.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Mycobacterium tuberculosis hemoglobin HbO associates with membranes and stimulates cellular respiration of recombinant Escherichia coli.
- J Biol Chem. 2002 May 3;277(18):15293-302. doi: 10.1074/jbc.M111478200. Epub 2002 Jan 16.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.