Rv2478c
- Type
- protein_coding
- Name
- Rv2478c
- Locus Name
-
Rv2478c
- Product
-
Conserved hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 2784123..2784608 (- strand)
- Gene Length
- 485 bp
- Nucleotides
-
GTGGTCGGTCACATCGTCAACGATTTGCAGCGCCGCAAAGTCGGTGATCAAGAGGTCGTCAAGTTCCGGGTGGCCAGCAATTCGCGCCGGCGCACCAGCGACGGCGGTTGGGAGCCCGGCAACTCGCTGTTTATCACCGTCAATTGCTGGGGAAGGCTGGTCACCGGGGTGGGCGCAGCATTGGGCAAGGGCGCACCGGTGATTGTGGTGGGACACGTGTACACCAGTGAATATGAGGACCGGGACGGCATTCGTCGCTCGTCGCTGGAGATGCGGGCGACGTCGGTAGGGCCGGATTTGTCGCGCGTGATCGTGCGCATCGAAAAGCCGGCCTACACCGGTCCAAGCGCCGGTGATCTCCCGGCCGCCACGGGGACCGGGGCGGCCGGTGCCGCCGACGCCCCAGCGTCGGCAGCCGACTCGGTTTCCGATGTCGTGGTCGACGACGCCATCACTGGCCACAACCCCCTGCCCATATCGGCTTA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- single-stranded DNA binding GO:0003697 molecular_function
- DNA replication GO:0006260 biological_process
- positive regulation of helicase activity GO:0051096 biological_process
- InterPro
- Name
- Uncharacterized protein
- Family
- Unknown
- Protein Sequence
-
MVGHIVNDLQRRKVGDQEVVKFRVASNSRRRTSDGGWEPGNSLFITVNCWGRLVTGVGAALGKGAPVIVVGHVYTSEYEDRDGIRRSSLEMRATSVGPDLSRVIVRIEKPAYTGPSAGDLPAATGTGAAGAADAPASAADSVSDVVVDDAITGHNPLPISA
- Mass
- 16,708 Da
- Length
- 161 Aa
Rv2478c doesn't seem to be a targeted by any drug.
-
-
Homologous recombination mtu03440
mtu03440Genetic Information Processing; Replication and repair
-
-
-
Mismatch repair mtu03430
mtu03430The Escherichia coli MMR pathway has been extensively studied and is well characterized. In E. coli, the mismatch-activated MutS-MutL-ATP complex licenses MutH to incise the nearest unmethylated GATC sequence. UvrD and an exonuclease generate a gap. This gap is filled by pol III and DNA ligase. The GATC sites are then methylated by Dam. Several human MMR proteins have been identified based on their homology to E. coli MMR proteins. These include human homologs of MutS and MutL. Although E. coli MutS and MutL proteins are homodimers, human MutS and MutL homologs are heterodimers. The role of hemimethylated dGATC sites as a signal for strand discrimination is not conserved from E. coli to human. Human MMR is presumed to be nick-directed in vivo, and is thought to discriminate daughter and template strands using a strand-specific nick.
-
-
-
DNA replication mtu03030
mtu03030Genetic Information Processing; Replication and repair
-
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.