bcp
- Type
- protein_coding
- Name
- bcp
- Locus Name
-
Rv2521
- Product
-
Probable bacterioferritin comigratory protein Bcp
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 2837684..2838157 (+ strand)
- Gene Length
- 473 bp
- Nucleotides
-
TGACCAAAACCACGCGTCTGACCCCCGGAGACAAAGCCCCTGCCTTCACCCTGCCCGATGCCGACGGCAACAACGTGTCGCTGGCCGACTACCGAGGACGCCGCGTCATCGTGTACTTCTACCCGGCGGCCTCGACACCGGGATGCACCAAGCAGGCTTGTGATTTTCGCGACAATCTGGGCGATTTCACCACTGCCGGCCTCAACGTCGTCGGTATCTCCCCCGACAAGCCGGAGAAGCTCGCTACGTTCCGCGATGCCCAGGGCCTGACGTTTCCGCTGCTGTCTGATCCCGACCGCGAGGTGTTGACGGCCTGGGGTGCCTACGGGGAGAAGCAGATGTATGGCAAGACGGTGCAGGGGGTGATCCGGTCCACCTTCGTCGTCGATGAAGACGGAAAGATCGTCGTCGCGCAGTACAACGTCAAGGCCACCGGCCACGTCGCTAAGCTTCGGCGCGACCTGTCGGTATAG
- Drug Resistance
- Mutations
- Function
- Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. {ECO:0000250|UniProtKB:P0AE52}.
- Family
-
Peroxiredoxin family, BCP/PrxQ subfamily
- GO
-
- cellular response to oxidative stress GO:0034599 biological_process
- cytosol GO:0005829 cellular_component
- thioredoxin peroxidase activity GO:0008379 molecular_function
- plasma membrane GO:0005886 cellular_component
- cytoplasm GO:0005737 cellular_component
- cell redox homeostasis GO:0045454 biological_process
- InterPro
Summary
- Name
- Putative peroxiredoxin Rv2521 (EC 1.11.1.15) (Bacterioferritin comigratory protein) (Thioredoxin peroxidase)
- Family
- Peroxiredoxin family, BCP/PrxQ subfamily
- Protein Sequence
-
MTKTTRLTPGDKAPAFTLPDADGNNVSLADYRGRRVIVYFYPAASTPGCTKQACDFRDNLGDFTTAGLNVVGISPDKPEKLATFRDAQGLTFPLLSDPDREVLTAWGAYGEKQMYGKTVQGVIRSTFVVDEDGKIVVAQYNVKATGHVAKLRRDLSV
- Mass
- 17,077 Da
- Length
- 157 Aa
Rv2521 doesn't seem to be a targeted by any drug.
Rv2521 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected] .
- PLoS One. 2010 Jan 6;5(1):e8589. doi: 10.1371/journal.pone.0008589.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.