acpS
- Type
- protein_coding
- Name
- acpS
- Locus Name
-
Rv2523c
- Product
-
holo-[acyl-carrier protein] synthase AcpS (holo-ACP synthase) (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase)
- Functional Category
-
Lipid metabolism
- Location
- 2839538..2839930 (- strand)
- Gene Length
- 392 bp
- Nucleotides
-
ATGGGCATCGTCGGTGTGGGGATCGACCTGGTCTCCATTCCCGATTTCGCCGAGCAGGTCGACCAGCCCGGAACGGTGTTCGCCGAGACCTTCACCCCGGGTGAGCGCCGGGACGCCTCGGACAAGAGTTCGTCGGCGGCCCGGCACCTGGCGGCCCGCTGGGCCGCGAAGGAGGCGGTGATCAAGGCCTGGTCCGGATCGCGGTTCGCGCAGCGGCCGGTGTTGCCGGAGGACATCCACCGCGATATCGAGGTGGTCACCGATATGTGGGGCAGGCCGCGGGTCAGGCTGACCGGGGCCATCGCTGAGTATTTGGCCGACGTGACGATCCATGTGTCGCTGACCCACGAAGGGGATACCGCGGCCGCGGTCGCCATCCTGGAGGCCCCGTG
- Drug Resistance
- Mutations
- Function
- Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein. {ECO:0000255|HAMAP-Rule:MF_00101}.
- Family
-
P-Pant transferase superfamily, AcpS family
- GO
-
- magnesium ion binding GO:0000287 molecular_function
- cytoplasm GO:0005737 cellular_component
- holo-[acyl-carrier-protein] synthase activity GO:0008897 molecular_function
- fatty acid biosynthetic process GO:0006633 biological_process
- InterPro
3H7Q
- Name
- Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS)
- Family
- P-Pant transferase superfamily, AcpS family
- Protein Sequence
-
MGIVGVGIDLVSIPDFAEQVDQPGTVFAETFTPGERRDASDKSSSAARHLAARWAAKEAVIKAWSGSRFAQRPVLPEDIHRDIEVVTDMWGRPRVRLTGAIAEYLADVTIHVSLTHEGDTAAAVAILEAP
- Mass
- 14,003 Da
- Length
- 130 Aa
Summary
Rv2523c doesn't seem to be a targeted by any drug.
-
-
Pantothenate and CoA biosynthesis mtu00770
mtu00770PATHWAY_MAP mtu00770 Pantothenate and CoA biosynthesis
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.