nusB
- Type
- protein_coding
- Name
- nusB
- Locus Name
-
Rv2533c
- Product
-
N utilization substance protein NusB (NusB protein)
- Functional Category
-
Information pathways
- Location
- 2858254..2858724 (- strand)
- Gene Length
- 470 bp
- Nucleotides
-
ATGTCGGACAGAAAGCCGGTTCGCGGACGACATCAGGCCCGTAAGCGCGCGGTGGCCCTGCTGTTCGAGGCCGAGGTCCGCGGCATCAGCGCGGCCGAGGTGGTCGACACCCGTGCCGCGCTGGCCGAAGCGAAGCCCGACATTGCCCGGCTACATCCGTACACGGCCGCGGTGGCTCGAGGGGTCAGTGAACACGCCGCCCACATCGACGACCTGATCACCGCGCATCTGCGGGGCTGGACGCTGGACCGGTTGCCCGCCGTGGATCGCGCCATTCTGCGCGTCTCGGTATGGGAGCTGCTCCACGCGGCGGATGTGCCGGAGCCGGTGGTCGTCGACGAGGCCGTCCAGCTGGCCAAGGAGCTGTCGACCGACGACTCGCCGGGCTTTGTCAACGGGGTGCTGGGCCAGGTCATGCTGGTGACCCCGCAGCTGCGTGCGGCCGCTCAAGCGGTGCGTGGGGGGGCGTG
- Drug Resistance
- Mutations
- Function
- Involved in transcription antitermination. Required for transcription of ribosomal RNA (rRNA) genes. Binds specifically to the boxA antiterminator sequence of the ribosomal RNA (rrn) operons. {ECO:0000255|HAMAP-Rule:MF_00073}.
- Family
-
NusB family
- GO
-
- RNA binding GO:0003723 molecular_function
- DNA-templated transcription, termination GO:0006353 biological_process
- transcription antitermination GO:0031564 biological_process
- InterPro
1EYV
- Name
- Transcription antitermination protein NusB (Antitermination factor NusB)
- Family
- NusB family
- Protein Sequence
-
MSDRKPVRGRHQARKRAVALLFEAEVRGISAAEVVDTRAALAEAKPDIARLHPYTAAVARGVSEHAAHIDDLITAHLRGWTLDRLPAVDRAILRVSVWELLHAADVPEPVVVDEAVQLAKELSTDDSPGFVNGVLGQVMLVTPQLRAAAQAVRGGA
- Mass
- 16,740 Da
- Length
- 156 Aa
Summary
Rv2533c doesn't seem to be a targeted by any drug.
Rv2533c doesn't seem to be involved in any pathway.
- The crystal structure of NusB from Mycobacterium tuberculosis.
- Nat Struct Biol. 2000 Jun;7(6):475-8. doi: 10.1038/75876.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.