Rv2599
- Type
- protein_coding
- Name
- Rv2599
- Locus Name
-
Rv2599
- Product
-
Probable conserved membrane protein
- Functional Category
-
Cell wall and cell processes
- Location
- 2927477..2927908 (+ strand)
- Gene Length
- 431 bp
- Nucleotides
-
TGAGCCGCAACCGCCTGTTCCTGGTTGCCGGCAGCTTGGCGGTTGCCGCCGCCGTGTCCTTGATCTCTGGAATCACGCTGCTGAACAGGGACGTTGGCTCGTATATCGCCTCGCACTATCGCCAAGAATCCCGTGACGTGAACGGAACGCGATACCTGTGCACCGGATCGCCCAAACAGGTGGCCACCACGCTCGTCAAGTACCAGACCCCGGCGGCGCGCGCGTCGCATACCGACACCGAGTACCTGCGTTACCGCAACAACATCGTGACGGTCGGACCCGACGGCACCTATCCGTGCATCATCCGCGTCGAAAACCTCAGCGCCGGATATAACCACGGCGCATATGTCTTCCTGGGCCCTGGATTCACCCCTGGGTCCCCGTCGGGCGGTTCGGGGGGCAGCCCGGGCGGTCCTGGCGGCAGCAAGTAA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- extracellular region GO:0005576 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
Summary
- Name
- Uncharacterized protein Rv2599
- Family
- Unknown
- Protein Sequence
-
MSRNRLFLVAGSLAVAAAVSLISGITLLNRDVGSYIASHYRQESRDVNGTRYLCTGSPKQVATTLVKYQTPAARASHTDTEYLRYRNNIVTVGPDGTYPCIIRVENLSAGYNHGAYVFLGPGFTPGSPSGGSGGSPGGPGGSK
- Mass
- 14,955 Da
- Length
- 143 Aa
Rv2599 doesn't seem to be a targeted by any drug.
Rv2599 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.