hrp1
- Type
- protein_coding
- Name
- hrp1
- Locus Name
-
Rv2626c
- Product
-
Hypoxic response protein 1 Hrp1
- Functional Category
-
Conserved hypotheticals
- Location
- 2952562..2952993 (- strand)
- Gene Length
- 431 bp
- Nucleotides
-
ATGACCACCGCACGCGACATCATGAACGCAGGTGTGACCTGTGTTGGCGAACACGAGACGCTAACCGCTGCCGCTCAATACATGCGTGAGCACGACATCGGCGCGTTGCCGATCTGCGGGGACGACGACCGGCTGCACGGCATGCTCACCGACCGCGACATTGTGATCAAAGGCCTGGCTGCGGGCCTAGACCCGAATACCGCCACGGCTGGCGAGTTGGCCCGGGACAGCATCTACTACGTCGATGCGAACGCAAGCATCCAGGAGATGCTCAACGTCATGGAAGAACATCAGGTCCGCCGTGTTCCGGTCATCTCAGAGCACCGCTTGGTCGGAATCGTCACCGAAGCCGACATCGCCCGACACCTGCCCGAGCACGCCATTGTGCAGTTCGTCAAGGCAATCTGCTCGCCCATGGCCCTCGCCAGCTA
- Drug Resistance
- Mutations
- Function
- Unlike some other CBS-domain containing proteins does not seem to bind AMP.
- Family
-
Unknown
- GO
-
- response to hypoxia GO:0001666 biological_process
- plasma membrane GO:0005886 cellular_component
- response to host immune response GO:0052572 biological_process
- modulation by symbiont of host immune response GO:0052553 biological_process
- cytosol GO:0005829 cellular_component
- extracellular region GO:0005576 cellular_component
- cell wall GO:0005618 cellular_component
- metal ion binding GO:0046872 molecular_function
- InterPro
1XKF
- Name
- Hypoxic response protein 1 (HRP1)
- Family
- Unknown
- Protein Sequence
-
MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
- Mass
- 15,518 Da
- Length
- 143 Aa
Summary
Rv2626c doesn't seem to be a targeted by any drug.
Rv2626c doesn't seem to be involved in any pathway.
- The structure and unusual protein chemistry of hypoxic response protein 1, a latency antigen and highly expressed member of the DosR regulon in Mycobacterium tuberculosis.
- J Mol Biol. 2008 Nov 21;383(4):822-36. doi: 10.1016/j.jmb.2008.07.001. Epub 2008 Jul 9.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon.
- J Biol Chem. 2008 Jun 27;283(26):18032-9. doi: 10.1074/jbc.M802274200. Epub 2008 Apr 9.
- Mycobacterium tuberculosis senses host-derived carbon monoxide during macrophage infection.
- Cell Host Microbe. 2008 May 15;3(5):323-30. doi: 10.1016/j.chom.2008.03.007.
- Immunogenicity of eight dormancy regulon-encoded proteins of Mycobacterium tuberculosis in DNA-vaccinated and tuberculosis-infected mice.
- Infect Immun. 2007 Feb;75(2):941-9. doi: 10.1128/IAI.01137-06. Epub 2006 Dec 4.
- Crystallization of a protein using dehydration without a precipitant.
- Acta Crystallogr Sect F Struct Biol Cryst Commun. 2005 Jun 1;61(Pt 6):565-8. doi: 10.1107/S1744309105014235. Epub 2005 Jun 1.
- Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions.
- Microbiology. 2004 Nov;150(Pt 11):3821-9. doi: 10.1099/mic.0.27284-0.
- Expression of Th1-mediated immunity in mouse lungs induces a Mycobacterium tuberculosis transcription pattern characteristic of nonreplicating persistence.
- Proc Natl Acad Sci U S A. 2003 Jan 7;100(1):241-6. doi: 10.1073/pnas.0136863100. Epub 2002 Dec 27.
- Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.
- J Exp Med. 2003 Sep 1;198(5):705-13. doi: 10.1084/jem.20030205.
- Hypoxic response of Mycobacterium tuberculosis studied by metabolic labeling and proteome analysis of cellular and extracellular proteins.
- J Bacteriol. 2002 Jul;184(13):3485-91. doi: 10.1128/jb.184.13.3485-3491.2002.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin.
- Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7534-9. doi: 10.1073/pnas.121172498.