Rv2639c
- Type
- protein_coding
- Name
- Rv2639c
- Locus Name
-
Rv2639c
- Product
-
Probable conserved integral membrane protein
- Functional Category
-
Cell wall and cell processes
- Location
- 2965026..2965358 (- strand)
- Gene Length
- 332 bp
- Nucleotides
-
ATGGTGGTGCGGTCAATCCTGCTATTCGTCCTGGCGGCGGTTGCGGAGATCGGTGGCGCGTGGCTGGTATGGCAGGGCGTCCGCGAGCAACGGGGTTGGCTTTGGGCGGGACTCGGAGTTATTGCGCTTGGGGTCTATGGGTTCTTCGCCACATTGCAGCCGGACGCCCATTTCGGTCGGGTCTTGGCCGCCTACGGTGGTGTGTTTGTCGCCGGTTCGCTCGCCTGGGGCATGGCCCTGGACGGGTTCCGGCCCGACCGGTGGGATGTCATCGGTGCCCTTGGCTGCATGGCCGGGGTAGCCGTGATCATGTACGCCCCTCGCGGCCACTG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
UPF0060 family
- GO
-
- extracellular region GO:0005576 cellular_component
- integral component of plasma membrane GO:0005887 cellular_component
- InterPro
Summary
- Name
- UPF0060 membrane protein Rv2639c
- Family
- UPF0060 family
- Protein Sequence
-
MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGRVLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH
- Mass
- 11,720 Da
- Length
- 110 Aa
Rv2639c doesn't seem to be a targeted by any drug.
Rv2639c doesn't seem to be involved in any pathway.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.