Rv2640c
- Type
- protein_coding
- Name
- Rv2640c
- Locus Name
-
Rv2640c
- Product
-
Possible transcriptional regulatory protein (probably ArsR-family)
- Functional Category
-
Regulatory proteins
- Location
- 2965478..2965837 (- strand)
- Gene Length
- 359 bp
- Nucleotides
-
ATGCCCAAGTCGCTGCCGGTGATTGACATCTCCGCTCCCGTGTGCTGCGCCCCGGTGGCGGCGGGGCCGATGAGCGACGGCGACGCCTTGGCGGTGGCGCTGCGGCTGAAGGCCCTGGCCGACCCGGCACGAGTCAAGATCATGTCCTACCTGTTCAGCTCGCCGGCCGGCGAGCAGGTCAGCGGCCAACTAGCGGCGGCGCTCAGCCTCAGCGATGGCACCGTCAGCCACCACTTGGCCCAGCTGCGCAAGGCCGGCCTGGTCATTTCCGATCGCCGGGGCATGCACGTCTTCCATCGGGTACATCCTGAAGCCCTGCAAGCGCTGTGTACCGTGCTCAACCCGAACTGCTGCGCCTG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- transcription regulatory region DNA binding GO:0044212 molecular_function
- DNA-binding transcription factor activity GO:0003700 molecular_function
- regulation of transcription, DNA-templated GO:0006355 biological_process
- InterPro
Summary
- Name
- Possible transcriptional regulatory protein (Probably ArsR-family)
- Family
- Unknown
- Protein Sequence
-
MPKSLPVIDISAPVCCAPVAAGPMSDGDALAVALRLKALADPARVKIMSYLFSSPAGEQVSGQLAAALSLSDGTVSHHLAQLRKAGLVISDRRGMHVFHRVHPEALQALCTVLNPNCCA
- Mass
- 12,365 Da
- Length
- 119 Aa
Rv2640c doesn't seem to be a targeted by any drug.
Rv2640c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.