Rv2687c
- Type
- protein_coding
- Name
- Rv2687c
- Locus Name
-
Rv2687c
- Product
-
Antibiotic-transport integral membrane leucine and valine rich protein ABC transporter
- Functional Category
-
Cell wall and cell processes
- Location
- 3004035..3004748 (- strand)
- Gene Length
- 713 bp
- Nucleotides
-
ATGACCCGGTTGGTGCCTGCGCTGCGGCTCGAGCTGACGCTACAGGTGCGGCAGAAGTTCTTGCATGCCGCCGTTTTCTCCGGACTGATTTGGCTGGCAGTGCTGCTGCCGATGCCGGTCAGCCTGCGCCCGGTCGCCGAACCCTATGTCCTGGTGGGTGATATCGCGATCATCGGGTTCTTCTTCGTCGGCGGGACCGTGTTCTTCGAGAAGCAGGAGCGCACGATCGGCGCGATCGTCTCGACGCCGCTGCGGTTCTGGGAGTACCTGGCTGCCAAACTAACTGTGCTGCTGGCGATCTCGCTGTTCGTTGCGGTTGTCGTGGCCACCATCGTTCACGGGCTTGGTTACCACCTGCTGCCGCTGGTGGCCGGCATCGTGCTGGGCACACTGCTGATGCTGCTGGTCGGCTTCAGTTCCTCGTTGCCGTTCGCCTCGGTGACCGATTGGTTCCTGGCGGCGGTCATCCCGCTCGCGATCATGCTGGCGCCGCCGGTGGTGCACTACTCCGGCCTGTGGCCCAACCCGGTGCTTTACCTCATCCCCACCCAGGGGCCGCTGCTCTTGCTCGGCGCGGCGTTCGATCAGGTGAGCTTGGCGCCCTGGCAGGTCGGGTATGCGGTGGTCTACCCAATCGTGTGTGCGGCGGGATTGTGCCGGGCGGCCAAGGCGCTATTCGGCCGTTATGTCGTGCAAAGATCGGGTGTGCTGTG
- Drug Resistance
- Mutations
- Function
- Part of the ABC transporter complex Rv2686c/Rv2687c/Rv2688c involved in fluoroquinolones export. Confers resistance to ciprofloxacin and, to a lesser extent, norfloxacin, moxifloxacin and sparfloxacin. Probably responsible for the translocation of the substrate across the membrane. {ECO:0000269|PubMed:15273144}.
- Family
-
Unknown
- GO
-
- response to antibiotic GO:0046677 biological_process
- transmembrane transport GO:0055085 biological_process
- efflux transmembrane transporter activity GO:0015562 molecular_function
- plasma membrane GO:0005886 cellular_component
- integral component of membrane GO:0016021 cellular_component
- InterPro
-
- Unknown
Summary
- Name
- Fluoroquinolones export permease protein Rv2687c
- Family
- Unknown
- Protein Sequence
-
MTRLVPALRLELTLQVRQKFLHAAVFSGLIWLAVLLPMPVSLRPVAEPYVLVGDIAIIGFFFVGGTVFFEKQERTIGAIVSTPLRFWEYLAAKLTVLLAISLFVAVVVATIVHGLGYHLLPLVAGIVLGTLLMLLVGFSSSLPFASVTDWFLAAVIPLAIMLAPPVVHYSGLWPNPVLYLIPTQGPLLLLGAAFDQVSLAPWQVGYAVVYPIVCAAGLCRAAKALFGRYVVQRSGVL
- Mass
- 25,576 Da
- Length
- 237 Aa
Rv2687c doesn't seem to be a targeted by any drug.
-
-
ABC transporters mtu02010
mtu02010Environmental Information Processing; Membrane transport
-
- Rv2686c-Rv2687c-Rv2688c, an ABC fluoroquinolone efflux pump in Mycobacterium tuberculosis.
- Antimicrob Agents Chemother. 2004 Aug;48(8):3175-8. doi: 10.1128/AAC.48.8.3175-3178.2004.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.