ideR
- Type
- protein_coding
- Name
- ideR
- Locus Name
-
Rv2711
- Product
-
Iron-dependent repressor and activator IdeR
- Functional Category
-
Regulatory proteins
- Location
- 3023565..3024257 (+ strand)
- Gene Length
- 692 bp
- Nucleotides
-
TGAACGAGTTGGTTGATACCACCGAGATGTACCTGCGGACCATCTACGACCTCGAGGAAGAGGGCGTGACGCCACTGCGTGCCCGGATCGCCGAGCGGCTCGACCAGAGCGGGCCGACGGTCAGCCAGACCGTGTCCCGGATGGAGCGCGATGGGCTACTTCGGGTGGCTGGCGATCGCCACCTGGAGCTCACCGAAAAGGGCCGCGCGCTGGCCATCGCCGTGATGCGCAAGCACCGCCTCGCCGAACGGCTCCTCGTCGATGTCATCGGGTTGCCGTGGGAAGAAGTTCACGCCGAGGCATGCCGGTGGGAGCACGTGATGAGCGAGGACGTCGAGCGACGGCTGGTCAAGGTGCTCAACAACCCGACCACGTCCCCGTTCGGCAACCCGATCCCGGGCCTGGTGGAACTTGGCGTGGGCCCGGAACCGGGCGCCGACGACGCCAACCTGGTCCGGTTGACCGAGTTGCCGGCCGGCTCGCCGGTCGCAGTCGTCGTCCGCCAGCTTACCGAGCACGTTCAGGGCGACATCGACCTGATCACGCGGCTAAAAGACGCCGGCGTGGTGCCCAACGCACGAGTAACCGTCGAAACCACCCCAGGCGGCGGCGTGACCATCGTCATCCCGGGCCATGAGAACGTCACCCTGCCACACGAGATGGCCCACGCGGTCAAGGTCGAGAAAGTCTGA
- Drug Resistance
- Mutations
- Function
- Metal-dependent DNA-binding protein that controls transcription of many genes involved in iron metabolism. Acts as a repressor of siderophore biosynthesis and as a positive modulator of iron storage. Also regulates expression of transporters, proteins involved in siderophore synthesis, iron storage and transcriptional regulators. {ECO:0000269|PubMed:11722747, ECO:0000269|PubMed:12065475}.
- Family
-
DtxR/MntR family
- GO
-
- protein dimerization activity GO:0046983 molecular_function
- cadmium ion binding GO:0046870 molecular_function
- siderophore biosynthetic process from catechol GO:0019540 biological_process
- transcription regulatory region sequence-specific DNA binding GO:0000976 molecular_function
- DNA-binding transcription factor activity GO:0003700 molecular_function
- DNA-binding transcription repressor activity GO:0001217 molecular_function
- manganese ion binding GO:0030145 molecular_function
- cell wall GO:0005618 cellular_component
- iron ion binding GO:0005506 molecular_function
- DNA binding GO:0003677 molecular_function
- negative regulation of transcription, DNA-templated GO:0045892 biological_process
- regulation of transcription, DNA-templated GO:0006355 biological_process
- plasma membrane GO:0005886 cellular_component
- cytoplasm GO:0005737 cellular_component
- cobalt ion binding GO:0050897 molecular_function
- ferrous iron binding GO:0008198 molecular_function
- zinc ion binding GO:0008270 molecular_function
- nickel cation binding GO:0016151 molecular_function
- response to oxidative stress GO:0006979 biological_process
- InterPro
1B1B
- Name
- Iron-dependent repressor IdeR
- Family
- DtxR/MntR family
- Protein Sequence
-
MNELVDTTEMYLRTIYDLEEEGVTPLRARIAERLDQSGPTVSQTVSRMERDGLLRVAGDRHLELTEKGRALAIAVMRKHRLAERLLVDVIGLPWEEVHAEACRWEHVMSEDVERRLVKVLNNPTTSPFGNPIPGLVELGVGPEPGADDANLVRLTELPAGSPVAVVVRQLTEHVQGDIDLITRLKDAGVVPNARVTVETTPGGGVTIVIPGHENVTLPHEMAHAVKVEKV
- Mass
- 25,233 Da
- Length
- 230 Aa
Summary
Rv2711 doesn't seem to be a targeted by any drug.
Rv2711 doesn't seem to be involved in any pathway.
- Crystal structure of the iron-dependent regulator (IdeR) from Mycobacterium tuberculosis shows both metal binding sites fully occupied.
- J Mol Biol. 1999 Jan 22;285(3):1145-56. doi: 10.1006/jmbi.1998.2339.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response.
- Infect Immun. 2002 Jul;70(7):3371-81. doi: 10.1128/iai.70.7.3371-3381.2002.
- The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages.
- Mol Microbiol. 2001 Nov;42(3):851-65.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Genomic organization of the mycobacterial sigma gene cluster.
- Gene. 1995 Nov 7;165(1):67-70.