nrdR
- Type
- protein_coding
- Name
- nrdR
- Locus Name
-
Rv2718c
- Product
-
Probable transcriptional regulatory protein NrdR
- Functional Category
-
Regulatory proteins
- Location
- 3030413..3030877 (- strand)
- Gene Length
- 464 bp
- Nucleotides
-
ATGCATTGCCCGTTCTGCCGGCATCCCGATTCGCGGGTGATCGATTCCCGGGAAACCGATGAAGGCCAGGCGATCCGGCGCCGGAGGTCGTGCCCCGAATGTGGACGACGATTCACCACCGTAGAGACCGCGGTGCTGGCCGTAGTCAAGCGCAGTGGCGTTACCGAACCCTTCAGCAGGGAAAAGGTGATCAGCGGTGTGCGCCGGGCGTGCCAGGGACGCCAGGTCGACGACGATGCGTTGAACCTGCTGGCTCAGCAAGTCGAGGATTCGGTGCGTGCCGCGGGGTCGCCGGAGATTCCGAGTCACGATGTCGGCCTGGCTATCCTGGGCCCGTTGCGCGAGCTTGACGAGGTGGCCTACCTACGGTTCGCGTCGGTCTACCGGTCGTTTTCTTCCGCGGACGATTTCGCGCGCGAGATTGAGGCGCTTCGCGCGCACCGCAACCTATCAGCCCACAGCTG
- Drug Resistance
- Mutations
- Function
- Negatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR-boxes. {ECO:0000255|HAMAP-Rule:MF_00440}.
- Family
-
NrdR family
- GO
-
- ATP binding GO:0005524 molecular_function
- cytosol GO:0005829 cellular_component
- DNA binding GO:0003677 molecular_function
- negative regulation of transcription, DNA-templated GO:0045892 biological_process
- zinc ion binding GO:0008270 molecular_function
- InterPro
Summary
- Name
- Transcriptional repressor NrdR
- Family
- NrdR family
- Protein Sequence
-
MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVKRSGVTEPFSREKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAGSPEIPSHDVGLAILGPLRELDEVAYLRFASVYRSFSSADDFAREIEALRAHRNLSAHS
- Mass
- 17,177 Da
- Length
- 154 Aa
Rv2718c doesn't seem to be a targeted by any drug.
Rv2718c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.