Gene - combatTB X

lexA

Type: protein_coding
Name: lexA
Locus Name: Rv2720
Product: Repressor LexA
Functional Category: Regulatory proteins
Location: 3031788..3032498 (+ strand)
Gene Length: 710 bp
Nucleotides: TGAACGACAGCAACGACACCTCGGTTGCCGGCGGAGCCGCTGGTGCGGACAGCCGGGTGCTGTCCGCAGATTCGGCGCTGACCGAGCGGCAACGCACTATTCTCGACGTCATCCGCGCGTCGGTCACTAGCCGCGGATATCCGCCGAGCATCCGGGAAATCGGCGACGCCGTTGGTCTGACGTCGACGTCTTCGGTGGCGCACCAGCTGCGCACCCTGGAGCGCAAGGGCTACCTACGCCGTGACCCGAACCGCCCCCGCGCCGTCAATGTGCGCGGTGCCGACGACGCCGCCCTACCGCCGGTGACCGAAGTGGCCGGCTCGGACGCCTTACCGGAACCCACCTTTGTCCCTGTCCTGGGACGTATCGCGGCCGGCGGCCCGATCCTTGCCGAGGAAGCCGTTGAAGACGTCTTCCCGCTGCCGCGTGAGCTGGTTGGCGAGGGCACCCTGTTCCTGCTCAAGGTGATCGGTGACTCGATGGTCGAAGCCGCGATCTGCGACGGTGACTGGGTGGTGGTGCGACAGCAGAACGTCGCCGACAACGGCGACATCGTTGCGGCCATGATCGACGGTGAGGCCACCGTCAAGACGTTCAAACGCGCCGGCGGTCAGGTGTGGTTGATGCCGCACAACCCGGCCTTCGATCCCATCCCGGGCAACGACGCGACGGTGCTGGGCAAGGTCGTCACGGTGATCCGCAAGGTCTGA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. Has been shown to bind to the 14 bp palindromic sequence 5'-CGAACNNNNGTTCG-3'. In the presence of single-stranded DNA, RecA interacts with LexA causing an autocatalytic cleavage which disrupts the DNA-binding part of LexA, leading to derepression of the SOS regulon and eventually DNA repair.

Family

Peptidase S24 family

GO

SOS response GO:0009432 biological_process
response to antibiotic GO:0046677 biological_process
cell wall GO:0005618 cellular_component
DNA binding GO:0003677 molecular_function
DNA replication GO:0006260 biological_process
negative regulation of transcription, DNA-templated GO:0045892 biological_process
DNA repair GO:0006281 biological_process
cellular response to DNA damage stimulus GO:0006974 biological_process
serine-type endopeptidase activity GO:0004252 molecular_function

InterPro

UniProt: P9WHR7
GenBank: Rv2720
EnsemblBacteria: Rv2720
Mycobrowser: Rv2720

Summary

Name: LexA repressor (EC 3.4.21.88)
Family: Peptidase S24 family
Protein Sequence: MNDSNDTSVAGGAAGADSRVLSADSALTERQRTILDVIRASVTSRGYPPSIREIGDAVGLTSTSSVAHQLRTLERKGYLRRDPNRPRAVNVRGADDAALPPVTEVAGSDALPEPTFVPVLGRIAAGGPILAEEAVEDVFPLPRELVGEGTLFLLKVIGDSMVEAAICDGDWVVVRQQNVADNGDIVAAMIDGEATVKTFKRAGGQVWLMPHNPAFDPIPGNDATVLGKVVTVIRKV
Mass: 24,841 Da
Length: 236 Aa

Rv2720 doesn't seem to be a targeted by any drug.

Rv2720 doesn't seem to be involved in any pathway.

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Experimental determination of translational start sites resolves uncertainties in genomic open reading frame predictions - application to Mycobacterium tuberculosis.: Microbiology. 2009 Jan;155(Pt 1):186-97. doi: 10.1099/mic.0.022889-0.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Characterization of Mycobacterium tuberculosis LexA: recognition of a Cheo (Bacillus-type SOS) box.: Microbiology. 1997 Mar;143 ( Pt 3):929-36. doi: 10.1099/00221287-143-3-929.