recX
- Type
- protein_coding
- Name
- recX
- Locus Name
-
Rv2736c
- Product
-
Regulatory protein RecX
- Functional Category
-
Information pathways
- Location
- 3048562..3049086 (- strand)
- Gene Length
- 524 bp
- Nucleotides
-
ATGACGGTGTCCTGCCCGCCCCCGTCGACTTCTGAGCGCGAAGAGCAGGCGCGGGCACTGTGCCTGCGCCTGCTCACCGCGCGATCCCGCACCCGCGCCGAGTTAGCCGGCCAGCTGGCCAAGCGCGGCTACCCCGAAGACATCGGCAACCGGGTATTGGATCGGCTGGCCGCCGTTGGCCTGGTGGATGACACCGACTTCGCCGAACAATGGGTTCAGTCCAGGCGGGCGAACGCAGCAAAGAGCAAGCGCGCGTTGGCTGCCGAGCTGCACGCCAAGGGCGTCGACGACGACGTGATCACCACGGTGCTCGGGGGCATCGACGCCGGTGCCGAACGGGGGCGGGCGGAAAAGCTGGTACGGGCCAGGCTGCGGCGGGAGGTGCTGATCGACGACGGCACCGACGAAGCGCGGGTGAGCCGCAGGCTGGTGGCGATGTTGGCGCGCCGTGGGTACGGCCAGACCTTGGCGTGCGAGGTGGTTATCGCCGAGCTGGCCGCCGAGCGGGAGCGCCGACGCGTCTA
- Drug Resistance
- Mutations
- Function
- Binds to RecA inhibiting ATP hydrolysis and the generation of heteroduplex DNA. It might act as an anti-recombinase to quell inappropriate recombinational repair during normal DNA metabolism. It is essential for cell survival. {ECO:0000269|PubMed:12218174}.
- Family
-
RecX family
- GO
-
- regulation of DNA repair GO:0006282 biological_process
- plasma membrane GO:0005886 cellular_component
- cytoplasm GO:0005737 cellular_component
- InterPro
Summary
- Name
- Regulatory protein RecX
- Family
- RecX family
- Protein Sequence
-
MTVSCPPPSTSEREEQARALCLRLLTARSRTRAELAGQLAKRGYPEDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSKRALAAELHAKGVDDDVITTVLGGIDAGAERGRAEKLVRARLRREVLIDDGTDEARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV
- Mass
- 19,146 Da
- Length
- 174 Aa
Rv2736c doesn't seem to be a targeted by any drug.
Rv2736c doesn't seem to be involved in any pathway.
- RecX protein abrogates ATP hydrolysis and strand exchange promoted by RecA: insights into negative regulation of homologous recombination.
- Proc Natl Acad Sci U S A. 2002 Sep 17;99(19):12091-6. doi: 10.1073/pnas.192178999. Epub 2002 Sep 6.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.