clgR
- Type
- protein_coding
- Name
- clgR
- Locus Name
-
Rv2745c
- Product
-
Transcriptional regulatory protein ClgR
- Functional Category
-
Regulatory proteins
- Location
- 3058193..3058531 (- strand)
- Gene Length
- 338 bp
- Nucleotides
-
ATGGCGGCTTTGGTGCGTGAGGTCGTTGGTGACGTGCTGCGCGGAGCGCGGATGTCGCAGGGTCGGACGCTGCGCGAGGTGTCCGATTCGGCGCGGGTGAGCCTCGGGTATCTGTCGGAGATCGAGCGCGGTCGCAAGGAGCCTTCCAGCGAGCTGCTCAGTGCGATTTGTACGGCTCTGCAGCTCCCGTTGTCGGTGGTGCTCATCGATGCGGGCGAGCGGATGGCGCGTCAAGAGCGCCTTGCCCGCGCCACCCCGGCTGGCAGAGCAACCGGCGCCACCATTGACGCCAGCACCAAGGTCGTCATTGCGCCGGTGGTGTCGCTGGCGGTGGCCTA
- Drug Resistance
- Mutations
- Function
- Overexpression leads to expression of the clp regulon (ClpP1, ClpP2 and ClpC1). {ECO:0000250}.
- Family
-
Unknown
- GO
-
- response to acidic pH GO:0010447 biological_process
- response to heat GO:0009408 biological_process
- growth of symbiont in host cell GO:0044119 biological_process
- regulation of DNA-templated transcription in response to stress GO:0043620 biological_process
- sequence-specific DNA binding GO:0043565 molecular_function
- dormancy exit of symbiont in host GO:0085016 biological_process
- response to oxidative stress GO:0006979 biological_process
- regulation of trehalose metabolic process GO:0090062 biological_process
- regulation of proteasomal protein catabolic process GO:0061136 biological_process
- positive regulation of transcription, DNA-templated GO:0045893 biological_process
- DNA binding GO:0003677 molecular_function
- negative regulation by symbiont of host innate immune response GO:0052170 biological_process
- InterPro
Summary
- Name
- Transcriptional regulator ClgR
- Family
- Unknown
- Protein Sequence
-
MAALVREVVGDVLRGARMSQGRTLREVSDSARVSLGYLSEIERGRKEPSSELLSAICTALQLPLSVVLIDAGERMARQERLARATPAGRATGATIDASTKVVIAPVVSLAVA
- Mass
- 11,786 Da
- Length
- 112 Aa
Rv2745c doesn't seem to be a targeted by any drug.
Rv2745c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages.
- Mol Microbiol. 2001 Jul;41(2):423-37.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.