rpsO
- Type
- protein_coding
- Name
- rpsO
- Locus Name
-
Rv2785c
- Product
-
30S ribosomal protein S15 RpsO
- Functional Category
-
Information pathways
- Location
- 3093479..3093748 (- strand)
- Gene Length
- 269 bp
- Nucleotides
-
GTGGCGCTGACAGCCGAGCAAAAAAAGGAGATTCTGCGCTCCTACGGCCTGCATGAGACCGATACCGGATCCCCGGAAGCACAGATCGCGTTGCTGACCAAACGCATCGCCGACCTCACCGAGCATCTCAAGGTGCACAAGCACGACCATCATTCGCGGCGAGGACTGCTGTTGCTGGTGGGCCGGCGGCGCCGGCTGATCAAGTACATTTCCCAGATCGATGTGGAGCGTTATCGTTCACTCATCGAGCGGCTGGGCCTGCGTCGCTG
- Drug Resistance
- Mutations
- Function
- One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. {ECO:0000255|HAMAP-Rule:MF_01343}.; FUNCTION: Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome. {ECO:0000255|HAMAP-Rule:MF_01343}.
- Family
-
Universal ribosomal protein uS15 family
- GO
-
- cytosolic small ribosomal subunit GO:0022627 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- rRNA binding GO:0019843 molecular_function
- plasma membrane GO:0005886 cellular_component
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 30S ribosomal protein S15
- Family
- Universal ribosomal protein uS15 family
- Protein Sequence
-
MALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHHSRRGLLLLVGRRRRLIKYISQIDVERYRSLIERLGLRR
- Mass
- 10,475 Da
- Length
- 89 Aa
Rv2785c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.