pptT
- Type
- protein_coding
- Name
- pptT
- Locus Name
-
Rv2794c
- Product
-
Phosphopantetheinyl transferase PptT (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase)
- Functional Category
-
Lipid metabolism
- Location
- 3103257..3103940 (- strand)
- Gene Length
- 683 bp
- Nucleotides
-
ATGACGGTAGGCACGCTGGTGGCGTCGGTGTTGCCGGCGACCGTGTTCGAGGATTTGGCGTATGCCGAGTTGTACTCCGACCCACCCGGTCTCACCCCGCTGCCCGAGGAGGCGCCGTTGATCGCACGATCGGTTGCCAAGCGGCGCAACGAATTCATCACCGTGCGTCACTGCGCCCGCATCGCGCTGGACCAGCTCGGTGTGCCGCCGGCGCCGATCCTCAAGGGCGACAAGGGCGAACCGTGCTGGCCCGACGGCATGGTCGGTAGCCTCACCCACTGCGCCGGTTACCGCGGCGCGGTTGTCGGACGCAGGGATGCGGTGCGTTCCGTGGGCATCGACGCCGAACCGCACGACGTGTTGCCCAATGGTGTGCTGGATGCGATCAGCCTGCCGGCCGAGCGCGCCGACATGCCCCGCACCATGCCAGCGGCGTTGCATTGGGATCGAATCCTGTTCTGCGCCAAGGAAGCAACGTACAAGGCGTGGTTTCCGCTGACCAAGAGGTGGCTGGGTTTCGAGGACGCGCACATCACGTTCGAAACCGATAGCACCGGCTGGACGGGTCGCTTCGTCTCCCGTATCCTCATCGACGGGTCCACCCTGTCGGGTCCGCCGCTGACAACGCTGCGGGGACGCTGGTCGGTTGAGCGCGGACTGGTGCTGACCGCGATCGTGCTATG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
P-Pant transferase superfamily
- GO
-
- siderophore biosynthetic process GO:0019290 biological_process
- enterobactin synthetase complex GO:0009366 cellular_component
- magnesium ion binding GO:0000287 molecular_function
- enterobactin biosynthetic process GO:0009239 biological_process
- intrinsic component of plasma membrane GO:0031226 cellular_component
- plasma membrane GO:0005886 cellular_component
- holo-[acyl-carrier-protein] synthase activity GO:0008897 molecular_function
- InterPro
4QJK
- Name
- Phosphopantetheinyl transferase PptT (CoA:APO-[ACP]pantetheinephosphotransferase) (CoA:APO-[acyl-carrier protein]pantetheinephosphotransferase)
- Family
- P-Pant transferase superfamily
- Protein Sequence
-
MTVGTLVASVLPATVFEDLAYAELYSDPPGLTPLPEEAPLIARSVAKRRNEFITVRHCARIALDQLGVPPAPILKGDKGEPCWPDGMVGSLTHCAGYRGAVVGRRDAVRSVGIDAEPHDVLPNGVLDAISLPAERADMPRTMPAALHWDRILFCAKEATYKAWFPLTKRWLGFEDAHITFETDSTGWTGRFVSRILIDGSTLSGPPLTTLRGRWSVERGLVLTAIVL
- Mass
- 24,709 Da
- Length
- 227 Aa
Summary
Rv2794c doesn't seem to be a targeted by any drug.
Rv2794c doesn't seem to be involved in any pathway.
- Crystal structure of the essential Mycobacterium tuberculosis phosphopantetheinyl transferase PptT, solved as a fusion protein with maltose binding protein.
- J Struct Biol. 2014 Dec;188(3):274-8. doi: 10.1016/j.jsb.2014.10.004. Epub 2014 Oct 18.
- Structure, biochemistry, and inhibition of essential 4'-phosphopantetheinyl transferases from two species of Mycobacteria.
- ACS Chem Biol. 2014 Sep 19;9(9):1939-44. doi: 10.1021/cb500263p. Epub 2014 Jul 9.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.