Rv2821c
- Type
- protein_coding
- Name
- Rv2821c
- Locus Name
-
Rv2821c
- Product
-
Conserved hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 3128253..3128963 (- strand)
- Gene Length
- 710 bp
- Nucleotides
-
ATGACTACGAGCTACGCCAAGATCGAGATAACCGGGACACTGACCGTCCTGACGGGCCTGCAGATCGGGGCCGGCGATGGCTTCTCCGCCATCGGCGCGGTCGACAAGCCTGTCGTTCGTGATCCGCTGAGCAGGCTGCCGATGATTCCGGGTACCAGCCTGAAGGGCAAGGTCCGCACCTTGCTGTCCCGCCAATACGGCGCCGACACAGAAACGTTTTACAGGAAGCCGAATGAGGACCACGCCCATATCCGTCGGCTTTTCGGCGACACCGAGGAGTACATGACGGGCCGACTCGTCTTCCGCGACACGAAGCTCACCAACAAAGACGACCTCGAAGCCCGCGGCGCTAAGACTCTCACCGAGGTGAAATTCGAGAACGCCATCAACCGGGTGACCGCAAAGGCAAACCTTCGCCAGATGGAACGCGTGATCCCCGGCAGCGAGTTCGCGTTCTCACTTGTCTACGAGGTCTCCTTCGGCACCCCCGGCGAGGAACAGAAGGCGTCTCTGCCTTCCTCCGATGAGATCATCGAGGACTTCAACGCCATCGCGCGCGGCCTGAAGTTGCTCGAACTCGACTACCTCGGCGGCAGCGGAACCCGTGGCTACGGGCAGGTCAAGTTCAGCAACCTGAAAGCCCGCGCCGCAGTCGGCGCCCTCGACGGTTCTCTGCTGGAGAAGCTAAACCATGAACTCGCGGCTGTTTA
- Drug Resistance
- Mutations
- Function
- CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). The type III-A Csm effector complex binds crRNA and acts as a crRNA-guided RNase, DNase and cyclic oligoadenylate synthase; binding of target RNA cognate to the crRNA is required for all activities (Probable). This CRISPR-Cas system protects bacteria against transformation with plasmids containing DNA homologous to its spacer regions (PubMed:29979631). {ECO:0000269|PubMed:29979631, ECO:0000305|PubMed:29979631}.; FUNCTION: This subunit has the target ssRNA endonuclease activity; it cleaves multiple sites in the target RNA at 6 nucleotide intervals. {ECO:0000250|UniProtKB:A0A0A7HIF0}.
- Family
-
CRISPR-associated Csm3 family
- GO
-
- RNA binding GO:0003723 molecular_function
- defense response to virus GO:0051607 biological_process
- endonuclease activity GO:0004519 molecular_function
- InterPro
Summary
- Name
- CRISPR system Cms endoribonuclease Csm3 (EC 3.1.-.-) (CRISPR type III A-associated RAMP protein Csm3)
- Family
- CRISPR-associated Csm3 family
- Protein Sequence
-
MTTSYAKIEITGTLTVLTGLQIGAGDGFSAIGAVDKPVVRDPLSRLPMIPGTSLKGKVRTLLSRQYGADTETFYRKPNEDHAHIRRLFGDTEEYMTGRLVFRDTKLTNKDDLEARGAKTLTEVKFENAINRVTAKANLRQMERVIPGSEFAFSLVYEVSFGTPGEEQKASLPSSDEIIEDFNAIARGLKLLELDYLGGSGTRGYGQVKFSNLKARAAVGALDGSLLEKLNHELAAV
- Mass
- 25,773 Da
- Length
- 236 Aa
Rv2821c doesn't seem to be a targeted by any drug.
Rv2821c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis type III-A CRISPR/Cas system crRNA and its maturation have atypical features.
- FASEB J. 2019 Jan;33(1):1496-1509. doi: 10.1096/fj.201800557RR. Epub 2018 Jul 6.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.