Rv2822c
- Type
- protein_coding
- Name
- Rv2822c
- Locus Name
-
Rv2822c
- Product
-
Hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 3128973..3129347 (- strand)
- Gene Length
- 374 bp
- Nucleotides
-
ATGAGCGTCATCCAAGACGACTATGTGAAACAGGCCGAAGTAATTCGCGGCCTGCCAAAGAAAAAGAACGGCTTCGAGCTGACCACAACCCAGCTGCGGGTGCTACTCAGCCTGACCGCACAGCTCTTCGACGAGGCGCAGCAGAGCGCCAACCCCACGCTCCCGCGTCAGCTGAAGGAGAAGGTCCAGTACCTGCGGGTCCGGTTCGTCTACCAGTCCGGGCGTGAAGACGCGGTTAAGACATTCGTCCGAAACGCGAAACTCCTAGAAGCGCTGGAAGGGATAGGCGATAGCCGCGACGGGCTGCTGCGATTCTGCCGGTACATGGAAGCCCTAGCCGCATACAAGAAGTACCTCGATCCGAAGGACAAGTG
- Drug Resistance
- Mutations
- Function
- CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain spacers, sequences complementary to antecedent mobile elements, and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA). The type III-A Csm effector complex binds crRNA and acts as a crRNA-guided RNase, DNase and cyclic oligoadenylate synthase; binding of target RNA cognate to the crRNA is required for all activities (Probable). This CRISPR-Cas system protects bacteria against transformation with plasmids containing DNA homologous to its spacer regions (PubMed:29979631). {ECO:0000269|PubMed:29979631, ECO:0000305|PubMed:29979631}.; FUNCTION: This subunit may be involved in monitoring complementarity of crRNA and target RNA. {ECO:0000250|UniProtKB:A0A0A7HIX1}.
- Family
-
CRISPR-associated Csm2 family
- GO
-
- RNA binding GO:0003723 molecular_function
- defense response to virus GO:0051607 biological_process
- InterPro
Summary
- Name
- CRISPR system Cms protein Csm2 (CRISPR type III A-associated protein Csm2)
- Family
- CRISPR-associated Csm2 family
- Protein Sequence
-
MSVIQDDYVKQAEVIRGLPKKKNGFELTTTQLRVLLSLTAQLFDEAQQSANPTLPRQLKEKVQYLRVRFVYQSGREDAVKTFVRNAKLLEALEGIGDSRDGLLRFCRYMEALAAYKKYLDPKDK
- Mass
- 14,287 Da
- Length
- 124 Aa
Rv2822c doesn't seem to be a targeted by any drug.
Rv2822c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis type III-A CRISPR/Cas system crRNA and its maturation have atypical features.
- FASEB J. 2019 Jan;33(1):1496-1509. doi: 10.1096/fj.201800557RR. Epub 2018 Jul 6.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.