rbfA
- Type
- protein_coding
- Name
- rbfA
- Locus Name
-
Rv2838c
- Product
-
Probable ribosome-binding factor a RbfA (P15B protein)
- Functional Category
-
Information pathways
- Location
- 3144620..3145171 (- strand)
- Gene Length
- 551 bp
- Nucleotides
-
ATGGCTGATGCTGCTAGGGCGCGGCGGCTGGCCAAACGGATCGCCGCGATCGTCGCCTCGGCGATCGAGTACGAGATCAAGGATCCTGGATTGGCCGGGGTGACCATCACCGATGCGAAGGTGACCGCCGACTTGCACGATGCCACGGTGTACTACACGGTGATGGGACGCACGCTACACGACGAGCCGAACTGCGCCGGCGCGGCCGCCGCGCTGGAACGGGCCAAAGGGGTGCTGCGCACCAAGGTCGGGGCGGGCACCGGCGTTCGGTTCACTCCCACCTTGACGTTCACGCTCGACACGATCTCGGACAGTGTGCACCGGATGGACGAGTTGCTGGCCCGCGCTCGCGCCGCGGATGCCGATCTGGCGCGGGTCCGGGTGGGCGCCAAACCGGCGGGGGAGGCCGACCCGTACCGTGATAACGGGTCGGTGGCGCAATCACCGGCTCCCGGGGGACTGGGTATCAGAACGAGCGACGGACCCGAGGCTGTGGAGGCACCGCTCACTTGCGGGGGAGACACCGGTGACGACGATCGACCCAAGGAGTG
- Drug Resistance
- Mutations
- Function
- One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but not with 30S subunits that are part of 70S ribosomes or polysomes). Required for efficient processing of 16S rRNA. May interact with the 5'-terminal helix region of 16S rRNA. {ECO:0000255|HAMAP-Rule:MF_00003}.
- Family
-
RbfA family
- GO
-
- ribosome biogenesis GO:0042254 biological_process
- ribosomal small subunit binding GO:0043024 molecular_function
- maturation of SSU-rRNA GO:0030490 biological_process
- cytosol GO:0005829 cellular_component
- InterPro
Summary
- Name
- Ribosome-binding factor A
- Family
- RbfA family
- Protein Sequence
-
MADAARARRLAKRIAAIVASAIEYEIKDPGLAGVTITDAKVTADLHDATVYYTVMGRTLHDEPNCAGAAAALERAKGVLRTKVGAGTGVRFTPTLTFTLDTISDSVHRMDELLARARAADADLARVRVGAKPAGEADPYRDNGSVAQSPAPGGLGIRTSDGPEAVEAPLTCGGDTGDDDRPKE
- Mass
- 18,998 Da
- Length
- 183 Aa
Rv2838c doesn't seem to be a targeted by any drug.
Rv2838c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.