Gene - combatTB X

mpt83

Type: protein_coding
Name: mpt83
Locus Name: Rv2873
Product: Cell surface lipoprotein Mpt83 (lipoprotein P23)
Functional Category: Cell wall and cell processes
Location: 3183905..3184567 (+ strand)
Gene Length: 662 bp
Nucleotides: TGATCAACGTTCAGGCCAAACCGGCCGCAGCAGCGAGCCTCGCAGCCATCGCGATTGCGTTCTTAGCGGGTTGTTCGAGCACCAAACCCGTGTCGCAAGACACCAGCCCGAAACCGGCGACCAGCCCGGCGGCGCCCGTTACCACGGCGGCAATGGCTGACCCCGCAGCGGACCTGATTGGTCGTGGGTGCGCGCAATACGCGGCGCAAAATCCCACCGGTCCCGGATCGGTGGCCGGAATGGCGCAAGACCCGGTCGCTACCGCGGCTTCCAACAACCCGATGCTCAGTACCCTGACCTCGGCTCTGTCGGGCAAGCTGAACCCGGATGTGAATCTGGTCGACACCCTCAACGGCGGCGAGTACACCGTTTTCGCCCCCACCAACGCCGCATTCGACAAGCTGCCGGCGGCCACTATCGATCAACTCAAGACTGACGCCAAGCTGCTCAGCAGCATCCTGACCTACCACGTGATAGCCGGCCAGGCGAGTCCGAGCAGGATCGACGGCACCCATCAGACCCTGCAAGGTGCCGACCTGACGGTGATAGGCGCCCGCGACGACCTCATGGTCAACAACGCCGGTTTGGTATGTGGCGGAGTTCACACCGCCAACGCGACGGTGTACATGATCGATACGGTGCTGATGCCCCCGGCACAGTAA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Recombinant, non-modified protein stimulates secretion of cytokines (TNF-alpha, IL-6 and IL-12p40) by mouse macrophage cell lines in a TLR2-dependent fashion, which leads to increased host innate immunity responses against the bacterium (PubMed:22174456). Serves as a strong human and mouse antigen T cell antigen during M.tuberculosis infection, inducing strong IFN-gamma expression (PubMed:22567094). {ECO:0000269|PubMed:22174456, ECO:0000269|PubMed:22567094}.

Family

Unknown

GO

cell wall GO:0005618 cellular_component
extracellular space GO:0005615 cellular_component
extracellular region GO:0005576 cellular_component
response to host immune response GO:0052572 biological_process
plasma membrane GO:0005886 cellular_component

InterPro

UniProt: P9WNF3
GenBank: Rv2873
EnsemblBacteria: Rv2873
Mycobrowser: Rv2873

Summary

Name: Cell surface glycolipoprotein MPT83 (Lipoprotein p23)
Family: Unknown
Protein Sequence: MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGGVHTANATVYMIDTVLMPPAQ
Mass: 22,070 Da
Length: 220 Aa

Rv2873 doesn't seem to be a targeted by any drug.

Rv2873 doesn't seem to be involved in any pathway.

The secreted lipoprotein, MPT83, of Mycobacterium tuberculosis is recognized during human tuberculosis and stimulates protective immunity in mice.: PLoS One. 2012;7(5):e34991. doi: 10.1371/journal.pone.0034991. Epub 2012 May 2.
Recombinant MPT83 derived from Mycobacterium tuberculosis induces cytokine production and upregulates the function of mouse macrophages through TLR2.: J Immunol. 2012 Jan 15;188(2):668-77. doi: 10.4049/jimmunol.1102177. Epub 2011 Dec 14.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Molecular characterization of MPT83: a seroreactive antigen of Mycobacterium tuberculosis with homology to MPT70.: Scand J Immunol. 1996 May;43(5):490-9.