Gene - combatTB X

mpt53

Type: protein_coding
Name: mpt53
Locus Name: Rv2878c
Product: Soluble secreted antigen Mpt53 precursor
Functional Category: Cell wall and cell processes
Location: 3188876..3189397 (- strand)
Gene Length: 521 bp
Nucleotides: ATGAGTCTTCGCCTGGTGTCCCCGATCAAGGCGTTTGCGGACGGCATTGTGGCCGTTGCTATCGCGGTTGTCCTGATGTTCGGTCTGGCCAATACACCGCGAGCGGTGGCAGCCGATGAACGTCTGCAGTTCACCGCAACCACGCTCAGCGGTGCTCCCTTCGATGGCGCAAGCCTGCAAGGCAAGCCGGCGGTGTTGTGGTTCTGGACGCCGTGGTGCCCGTTCTGCAACGCAGAAGCCCCCAGCCTCAGCCAGGTAGCGGCCGCTAATCCGGCGGTCACCTTCGTCGGAATCGCCACCCGCGCCGACGTCGGGGCGATGCAGAGCTTTGTCTCGAAGTACAACCTGAATTTCACCAACCTCAATGACGCCGATGGTGTGATCTGGGCCCGCTACAACGTGCCTTGGCAACCGGCATTTGTGTTCTATCGCGCGGACGGCACATCGACGTTCGTCAACAACCCCACCGCGGCCATGTCTCAGGACGAGCTGTCCGGCCGGGTGGCTGCGCTGACGTCCTG
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Disulfide oxidoreductase that catalyzes the oxidation of reduced, unfolded secreted proteins to form disulfide bonds. Despite a weak homology to thioredoxin this cannot serve as a substrate for thioredoxin reductase. {ECO:0000269|PubMed:14597624}.

Family

Thioredoxin family

GO

cellular response to oxidative stress GO:0034599 biological_process
extracellular region GO:0005576 cellular_component
thioredoxin peroxidase activity GO:0008379 molecular_function
cytoplasm GO:0005737 cellular_component
cell redox homeostasis GO:0045454 biological_process
oxidation-reduction process GO:0055114 biological_process
oxidoreductase activity GO:0016491 molecular_function

InterPro

UniProt: P9WG65
GenBank: Rv2878c
EnsemblBacteria: Rv2878c
Mycobrowser: Rv2878c

Summary

Name: Soluble secreted antigen MPT53
Family: Thioredoxin family
Protein Sequence: MSLRLVSPIKAFADGIVAVAIAVVLMFGLANTPRAVAADERLQFTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEAPSLSQVAAANPAVTFVGIATRADVGAMQSFVSKYNLNFTNLNDADGVIWARYNVPWQPAFVFYRADGTSTFVNNPTAAMSQDELSGRVAALTS
Mass: 18,383 Da
Length: 173 Aa

Rv2878c doesn't seem to be a targeted by any drug.

Rv2878c doesn't seem to be involved in any pathway.

Gram-positive DsbE proteins function differently from Gram-negative DsbE homologs. A structure to function analysis of DsbE from Mycobacterium tuberculosis.: J Biol Chem. 2004 Jan 30;279(5):3516-24. doi: 10.1074/jbc.M311833200. Epub 2003 Nov 3.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Cloning, expression and significance of MPT53 for identification of secreted proteins of Mycobacterium tuberculosis.: Microb Pathog. 1999 Apr;26(4):207-19. doi: 10.1006/mpat.1998.0267.