rimM
- Type
- protein_coding
- Name
- rimM
- Locus Name
-
Rv2907c
- Product
-
Probable 16S rRNA processing protein RimM
- Functional Category
-
Information pathways
- Location
- 3216361..3216891 (- strand)
- Gene Length
- 530 bp
- Nucleotides
-
ATGGAGCTGGTAGTCGGGCGGGTGGTGAAGTCGCACGGTGTCACCGGCGAGGTCGTCGTCGAGATCCGCACCGACGACCCAGCTGACCGGTTTGCGCCGGGTACCAGGTTGCGCGCTAAGGGGCCTTTTGACGGTGGTGCCGAGGGCAGTGCGGTGAGTTACGTCATCGAAAGTGTGCGGCAGCACGGCGGCCGCCTGTTGGTGCGACTCGCTGGAGTGGCCGATCGAGACGCAGCCGATGCGTTGCGCGGCAGCTTGTTCGTGATCGACGCCGATGACTTGCCCCCGATCGACGAGCCGGACACCTATTACGATCACCAGCTGGTGGGGCTTATGGTCCAGACGGCGACGGGGGAGGGTGTTGGTGTCGTCACCGAAGTGGTGCACACCGCCGCTGGTGAGTTGCTGGCGGTCAAGCGTGATTCCGATGAGGTTTTGGTGCCGTTTGTGCGTGCCATCGTCACGTCGGTGTCATTGGACGACGGCATCGTTGAGATTGATCCGCCCCATGGCTTGCTGAATCTGGAGTA
- Drug Resistance
- Mutations
- Function
- An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes. {ECO:0000255|HAMAP-Rule:MF_00014}.
- Family
-
RimM family
- GO
-
- ribosomal small subunit biogenesis GO:0042274 biological_process
- ribosome binding GO:0043022 molecular_function
- ribosome GO:0005840 cellular_component
- rRNA processing GO:0006364 biological_process
- InterPro
Summary
- Name
- Ribosome maturation factor RimM
- Family
- RimM family
- Protein Sequence
-
MELVVGRVVKSHGVTGEVVVEIRTDDPADRFAPGTRLRAKGPFDGGAEGSAVSYVIESVRQHGGRLLVRLAGVADRDAADALRGSLFVIDADDLPPIDEPDTYYDHQLVGLMVQTATGEGVGVVTEVVHTAAGELLAVKRDSDEVLVPFVRAIVTSVSLDDGIVEIDPPHGLLNLE
- Mass
- 18,616 Da
- Length
- 176 Aa
Rv2907c doesn't seem to be a targeted by any drug.
Rv2907c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.