rpsP
- Type
- protein_coding
- Name
- rpsP
- Locus Name
-
Rv2909c
- Product
-
30S ribosomal protein S16 RpsP
- Functional Category
-
Information pathways
- Location
- 3217155..3217643 (- strand)
- Gene Length
- 488 bp
- Nucleotides
-
ATGGCTGTGAAGATCAAGCTCACTCGGCTTGGCAAGATCCGCAATCCTCAGTACCGCGTCGCCGTCGCCGATGCGCGCACCCGCCGCGACGGCCGAGCGATCGAGGTAATCGGCCGGTACCACCCCAAAGAAGAGCCGAGTCTCATCGAGATCAACTCCGAGCGTGCCCAGTACTGGCTCTCGGTGGGTGCTCAGCCCACCGAGCCCGTCCTCAAGCTGCTGAAGATCACCGGGGATTGGCAGAAGTTTAAGGGCCTACCTGGCGCTCAGGGCCGGTTGAAGGTCGCCGCACCCAAGCCCAGCAAGCTCGAGGTGTTCAACGCCGCGTTGGCCGCCGCCGACGGTGGTCCTACCACCGAGGCCACCAAACCGAAGAAGAAGTCGCCGGCCAAAAAGGCTGCCAAGGCTGCTGAGCCAGCGCCGCAGCCTGAGCAGCCGGACACGCCGGCGCTGGGTGGCGAGCAGGCCGAGCTGACGGCGGAAAGCTG
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Bacterial ribosomal protein bS16 family
- GO
-
- structural constituent of ribosome GO:0003735 molecular_function
- ribosome GO:0005840 cellular_component
- plasma membrane GO:0005886 cellular_component
- translation GO:0006412 biological_process
- InterPro
Summary
- Name
- 30S ribosomal protein S16
- Family
- Bacterial ribosomal protein bS16 family
- Protein Sequence
-
MAVKIKLTRLGKIRNPQYRVAVADARTRRDGRAIEVIGRYHPKEEPSLIEINSERAQYWLSVGAQPTEPVLKLLKITGDWQKFKGLPGAQGRLKVAAPKPSKLEVFNAALAAADGGPTTEATKPKKKSPAKKAAKAAEPAPQPEQPDTPALGGEQAELTAES
- Mass
- 17,437 Da
- Length
- 162 Aa
Rv2909c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.