Gene - combatTB X

glnB

Type: protein_coding
Name: glnB
Locus Name: Rv2919c
Product: Probable nitrogen regulatory protein P-II GlnB
Functional Category: Regulatory proteins
Location: 3230738..3231076 (- strand)
Gene Length: 338 bp
Nucleotides: ATGAAGCTGATCACTGCGATCGTGAAGCCGTTCACGCTCGACGACGTCAAGACGAGCCTCGAGGACGCGGGAGTGCTGGGGATGACGGTCAGTGAAATCCAGGGATACGGACGGCAGAAGGGCCACACGGAGGTTTACCGCGGGGCCGAATACTCGGTGGATTTCGTACCGAAGGTTCGGATCGAGGTCGTTGTTGACGATTCCATTGTCGACAAGGTCGTGGACAGCATTGTCCGGGCGGCGCGCACCGGCAAGATCGGCGACGGCAAGGTGTGGGTGAGTCCGGTAGACACCATCGTGCGGGTGCGCACCGGTGAACGCGGACACGACGCGTTATG
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

In nitrogen-limiting conditions, when the ratio of Gln to 2-ketoglutarate decreases, P-II is uridylylated to P-II-UMP. P-II-UMP allows the deadenylation of glutamine synthetase (GS), thus activating the enzyme. Conversely, in nitrogen excess P-II is deuridylated and promotes the adenylation of GS. P-II indirectly controls the transcription of the GS gene (glnA). P-II prevents NR-II-catalyzed conversion of NR-I to NR-I-phosphate, the transcriptional activator of glnA. When P-II is uridylylated to P-II-UMP, these events are reversed (By similarity). {ECO:0000250}.

Family

P(II) protein family

GO

growth of symbiont in host cell GO:0044119 biological_process
enzyme regulator activity GO:0030234 molecular_function
ATP binding GO:0005524 molecular_function
plasma membrane GO:0005886 cellular_component
ADP binding GO:0043531 molecular_function
regulation of nitrogen utilization GO:0006808 biological_process

InterPro

UniProt: P9WN31
GenBank: Rv2919c
EnsemblBacteria: Rv2919c
Mycobrowser: Rv2919c

Summary

Name: Nitrogen regulatory protein P-II
Family: P(II) protein family
Protein Sequence: MKLITAIVKPFTLDDVKTSLEDAGVLGMTVSEIQGYGRQKGHTEVYRGAEYSVDFVPKVRIEVVVDDSIVDKVVDSIVRAARTGKIGDGKVWVSPVDTIVRVRTGERGHDAL
Mass: 12,227 Da
Length: 112 Aa

Rv2919c doesn't seem to be a targeted by any drug.

Two-component system mtu02020
mtu02020
Environmental Information Processing; Signal transduction

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.