Gene - combatTB X

hupB

Type: protein_coding
Name: hupB
Locus Name: Rv2986c
Product: DNA-binding protein HU homolog HupB (histone-like protein) (HLP) (21-kDa laminin-2-binding protein)
Functional Category: Information pathways
Location: 3343176..3343820 (- strand)
Gene Length: 644 bp
Nucleotides: ATGAACAAAGCAGAGCTCATTGACGTGCTCACACAGAAATTGGGCTCGGACCGTCGGCAGGCGACCGCCGCCGTCGAGAATGTCGTTGACACGATTGTGCGTGCGGTACACAAAGGCGACAGCGTCACCATTACCGGGTTCGGTGTGTTCGAACAGCGTCGCCGCGCGGCTCGAGTGGCCCGCAATCCGCGTACCGGCGAGACAGTAAAGGTGAAGCCGACGTCGGTGCCGGCGTTCCGCCCGGGCGCGCAATTCAAAGCGGTTGTGTCTGGCGCGCAGCGTCTCCCGGCAGAAGGACCCGCTGTTAAGCGTGGTGTGGGGGCCAGTGCAGCCAAGAAGGTAGCGAAGAAGGCACCTGCCAAGAAGGCGACAAAGGCCGCCAAGAAGGCGGCGACCAAGGCGCCCGCCAGGAAGGCGGCGACCAAGGCGCCCGCCAAGAAAGCGGCGACCAAGGCGCCCGCCAAGAAAGCTGTCAAGGCCACGAAGTCACCCGCCAAGAAGGTGACCAAGGCGGTGAAGAAGACCGCGGTCAAGGCATCGGTGCGTAAGGCGGCGACCAAGGCGCCGGCAAAGAAGGCAGCGGCCAAGCGGCCGGCTACCAAGGCTCCCGCCAAGAAGGCAACCGCTCGGCGGGGTCGCAAATA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. Binds DNA non-specifically. Induces lymphoproliferation, particularly in health tuberculin reactors, and is immunogenic. Maybe involved in pathogenesis of inflammatory bowel disease (IBD) in patients with ulcerative colitis and Crohn disease (CD). Bound by anti-neutrophil cytoplasmic antibodies (pANCA), which are a hallmark of IBD. The binding is due to pANCA directed against HIST1H1D cross-reacting with DBH epitopes. In CD, target of a strong IgA response. {ECO:0000269|PubMed:10569769, ECO:0000269|PubMed:10645441}.

Family

Bacterial histone-like protein family

GO

cellular response to iron ion starvation GO:0010106 biological_process
transcription regulatory region sequence-specific DNA binding GO:0000976 molecular_function
DNA-binding transcription activator activity GO:0001216 molecular_function
chromosome condensation GO:0030261 biological_process
DNA protection GO:0042262 biological_process
protein-DNA complex GO:0032993 cellular_component
cell wall GO:0005618 cellular_component
extracellular region GO:0005576 cellular_component
cytosol GO:0005829 cellular_component
DNA binding GO:0003677 molecular_function
damaged DNA binding GO:0003684 molecular_function
double-stranded DNA binding GO:0003690 molecular_function
positive regulation of transcription, DNA-templated GO:0045893 biological_process
plasma membrane GO:0005886 cellular_component
supercoiled DNA binding GO:0097100 molecular_function
nucleoid organization GO:0090143 biological_process

InterPro

UniProt: P9WMK7
GenBank: Rv2986c
EnsemblBacteria: Rv2986c
Mycobrowser: Rv2986c

Summary

Name: DNA-binding protein HU homolog (21 kDa laminin-2-binding protein) (28 kDa iron-regulated protein) (Irep-28) (Histone-like protein) (Hlp)
Family: Bacterial histone-like protein family
Protein Sequence: MNKAELIDVLTQKLGSDRRQATAAVENVVDTIVRAVHKGDSVTITGFGVFEQRRRAARVARNPRTGETVKVKPTSVPAFRPGAQFKAVVSGAQRLPAEGPAVKRGVGASAAKKVAKKAPAKKATKAAKKAATKAPARKAATKAPAKKAATKAPAKKAVKATKSPAKKVTKAVKKTAVKASVRKAATKAPAKKAAAKRPATKAPAKKATARRGRK
Mass: 22,187 Da
Length: 214 Aa

Rv2986c doesn't seem to be a targeted by any drug.

Rv2986c doesn't seem to be involved in any pathway.

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.: BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
Identification of an immunogenic histone-like protein (HLPMt) of Mycobacterium tuberculosis.: Tuber Lung Dis. 1998;79(1):43-53. doi: 10.1054/tuld.1998.0004.
Identification and characterization of a major cell wall-associated iron-regulated envelope protein (Irep-28) in Mycobacterium tuberculosis.: Clin Vaccine Immunol. 2006 Oct;13(10):1137-42. doi: 10.1128/CVI.00125-06.
Decreased infectivity despite unaltered C3 binding by a DeltahbhA mutant of Mycobacterium tuberculosis.: Infect Immun. 2002 Dec;70(12):6751-60. doi: 10.1128/iai.70.12.6751-6760.2002.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Identification of a novel mycobacterial histone H1 homologue (HupB) as an antigenic target of pANCA monoclonal antibody and serum immunoglobulin A from patients with Crohn's disease.: Infect Immun. 1999 Dec;67(12):6510-7.