nrdH
- Type
- protein_coding
- Name
- nrdH
- Locus Name
-
Rv3053c
- Product
-
Probable glutaredoxin electron transport component of NRDEF (glutaredoxin-like protein) NrdH
- Functional Category
-
Information pathways
- Location
- 3414719..3414958 (- strand)
- Gene Length
- 239 bp
- Nucleotides
-
ATGACCGTGACCGTTTACACTAAGCCCGCGTGCGTACAGTGCAGTGCCACCTCCAAGGCGCTGGACAAGCAGGGCATCGCCTACCAGAAGGTTGATATCAGCCTGGATTCCGAAGCGCGGGACTACGTGATGGCGCTGGGTTACCTACAAGCACCCGTCGTGGTCGCCGGAAACGACCACTGGTCGGGTTTCCGCCCCGATCGCATCAAGGCGCTCGCCGGGGCAGCGCTGACCGCCTA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- electron transfer activity GO:0009055 molecular_function
- protein disulfide oxidoreductase activity GO:0015035 molecular_function
- cell GO:0005623 cellular_component
- cell redox homeostasis GO:0045454 biological_process
- InterPro
4F2I
- Name
- Probable glutaredoxin electron transport component of NRDEF (Glutaredoxin-like protein) NrdH
- Family
- Unknown
- Protein Sequence
-
MTVTVYTKPACVQCSATSKALDKQGIAYQKVDISLDSEARDYVMALGYLQAPVVVAGNDHWSGFRPDRIKALAGAALTA
- Mass
- 8,419 Da
- Length
- 79 Aa
Summary
Rv3053c doesn't seem to be a targeted by any drug.
Rv3053c doesn't seem to be involved in any pathway.
- The crystal structure of Mycobacterium tuberculosis NrdH at 0.87 A suggests a possible mode of its activity.
- Biochemistry. 2013 Jun 11;52(23):4056-65. doi: 10.1021/bi400191z. Epub 2013 May 28.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.