mmr
- Type
- protein_coding
- Name
- mmr
- Locus Name
-
Rv3065
- Product
-
Multidrugs-transport integral membrane protein Mmr
- Functional Category
-
Cell wall and cell processes
- Location
- 3430387..3430710 (+ strand)
- Gene Length
- 323 bp
- Nucleotides
-
TGATCTACCTATACCTCTTGTGCGCGATCTTCGCGGAAGTGGTGGCAACCAGCCTGCTCAAAAGCACGGAAGGGTTCACTCGGTTGTGGCCCACGGTGGGCTGTCTAGTGGGTTATGGCATCGCTTTCGCGCTGCTGGCCTTGTCGATCTCGCACGGCATGCAGACGGACGTCGCCTATGCGCTGTGGTCGGCAATCGGTACGGCCGCCATTGTGCTGGTCGCCGTACTGTTTCTCGGCTCGCCGATATCTGTGATGAAGGTGGTTGGCGTCGGCCTGATTGTCGTCGGCGTGGTCACGTTGAACCTGGCGGGTGCCCATTGA
- Drug Resistance
- Mutations
- Function
- Multidrug efflux pump. Confers resistance to tetraphenylphosphonium (TPP), erythromycin, ethidium bromide, acriflavine, safranin O, pyronin Y and methyl viologen. {ECO:0000269|PubMed:11574548, ECO:0000269|PubMed:9811672}.
- Family
-
Drug/metabolite transporter (DMT) superfamily, Small multidrug resistance (SMR) (TC 2.A.7.1) family, Mmr subfamily
- GO
-
- transmembrane transporter activity GO:0022857 molecular_function
- response to antibiotic GO:0046677 biological_process
- transmembrane transport GO:0055085 biological_process
- integral component of plasma membrane GO:0005887 cellular_component
- efflux transmembrane transporter activity GO:0015562 molecular_function
- InterPro
2IQ4
- Name
- Multidrug resistance protein Mmr
- Family
- Drug/metabolite transporter (DMT) superfamily, Small multidrug resistance (SMR) (TC 2.A.7.1) family, Mmr subfamily
- Protein Sequence
-
MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH
- Mass
- 11,083 Da
- Length
- 107 Aa
Summary
Rv3065 doesn't seem to be a targeted by any drug.
Rv3065 doesn't seem to be involved in any pathway.
- Functional analysis of novel multidrug transporters from human pathogens.
- J Biol Chem. 2001 Dec 21;276(51):48250-6. doi: 10.1074/jbc.M108231200. Epub 2001 Sep 26.
- mmr, a Mycobacterium tuberculosis gene conferring resistance to small cationic dyes and inhibitors.
- J Bacteriol. 1998 Nov;180(22):6068-71.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.