smpB
- Type
- protein_coding
- Name
- smpB
- Locus Name
-
Rv3100c
- Product
-
Probable SSRA-binding protein SmpB
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 3469301..3469783 (- strand)
- Gene Length
- 482 bp
- Nucleotides
-
GTGTCCAAGTCGTCGCGTGGCGGCCGGCAGATCGTTGCCAGCAATCGCAAAGCCCGGCACAACTATTCGATCATCGAGGTGTTCGAGGCCGGGGTTGCGCTGCAAGGCACGGAGGTGAAGAGCCTGCGGGAAGGGCAGGCGTCGCTGGCCGATTCGTTCGCCACCATCGACGACGGCGAAGTGTGGCTGCGCAACGCGCACATCCCGGAATACCGGCACGGCAGCTGGACCAACCACGAGCCGCGACGCAACCGCAAACTGCTGTTGCATCGCCGCCAGATCGACACCTTGGTCGGCAAGATCCGCGAAGGCAACTTCGCCCTGGTGCCGTTGTCGCTGTATTTCGCCGAAGGCAAGGTCAAGGTTGAGCTTGCGCTGGCCCGAGGCAAGCAAGCCCGCGACAAACGCCAGGACATGGCCCGTCGTGATGCCCAGCGTGAAGTGCTCCGCGAGTTGGGTCGGCGCGCTAAGGGCATGACCTG
- Drug Resistance
- Mutations
- Function
- Required for rescue of stalled ribosomes mediated by trans-translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tmRNA and SmpB together mimic tRNA shape, replacing the anticodon stem-loop with SmpB. tmRNA is encoded by the ssrA gene; the 2 termini fold to resemble tRNA(Ala) and it encodes a 'tag peptide', a short internal open reading frame. During trans-translation Ala-aminoacylated tmRNA acts like a tRNA, entering the A-site of stalled ribosomes, displacing the stalled mRNA. The ribosome then switches to translate the ORF on the tmRNA; the nascent peptide is terminated with the 'tag peptide' encoded by the tmRNA and targeted for degradation. The ribosome is freed to recommence translation, which seems to be the essential function of trans-translation. {ECO:0000255|HAMAP-Rule:MF_00023}.
- Family
-
SmpB family
- GO
-
- RNA binding GO:0003723 molecular_function
- cytosol GO:0005829 cellular_component
- trans-translation GO:0070929 biological_process
- InterPro
Summary
- Name
- SsrA-binding protein (Small protein B)
- Family
- SmpB family
- Protein Sequence
-
MSKSSRGGRQIVASNRKARHNYSIIEVFEAGVALQGTEVKSLREGQASLADSFATIDDGEVWLRNAHIPEYRHGSWTNHEPRRNRKLLLHRRQIDTLVGKIREGNFALVPLSLYFAEGKVKVELALARGKQARDKRQDMARRDAQREVLRELGRRAKGMT
- Mass
- 18,230 Da
- Length
- 160 Aa
Rv3100c doesn't seem to be a targeted by any drug.
Rv3100c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis possesses an unusual tmRNA rescue system.
- Tuberculosis (Edinb). 2014 Jan;94(1):34-42. doi: 10.1016/j.tube.2013.09.007. Epub 2013 Oct 9.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- An M. tuberculosis DNA fragment contains genes encoding cell division proteins ftsX and ftsE, a basic protein and homologues of PemK and small protein B.
- Gene. 1996 Oct 24;177(1-2):59-67.