Gene - combatTB X

Type: protein_coding
Name: ftsE
Locus Name: Rv3102c
Product: Putative cell division ATP-binding protein FtsE (septation component-transport ATP-binding protein ABC transporter)
Functional Category: Cell wall and cell processes
Location: 3470680..3471369 (- strand)
Gene Length: 689 bp
Nucleotides: ATGATCACCCTGGACCATGTCACCAAGCAGTACAAATCGTCGGCGCGTCCGGCGTTGGATGACATCAACGTCAAGATCGACAAGGGTGAGTTCGTCTTCCTGATCGGCCCGTCGGGTTCGGGCAAGTCAACCTTCATGCGGCTGCTGCTGGCAGCGGAGACGCCGACCAGTGGTGATGTCCGGGTCTCGAAGTTTCATGTCAACAAACTCCGCGGTCGCCACGTACCGAAGCTGCGTCAGGTGATCGGCTGCGTCTTCCAGGACTTTCGGTTGCTGCAGCAGAAGACGGTGTACGACAACGTCGCCTTCGCATTGGAGGTCATCGGCAAACGCACCGACGCGATCAACCGGGTGGTCCCCGAAGTGCTCGAGACGGTCGGTCTGTCCGGCAAGGCCAATCGGCTGCCAGACGAGCTGTCGGGCGGCGAGCAACAGCGCGTTGCGATCGCCCGCGCCTTTGTCAACCGGCCGCTGGTACTGCTGGCCGACGAGCCCACCGGAAACCTCGACCCGGAGACCAGTAGGGACATCATGGACTTATTGGAGCGGATCAACCGCACCGGCACGACGGTGCTGATGGCCACGCACGACCACCACATCGTCGACTCGATGCGCCAACGGGTGGTTGAGTTGTCCCTGGGCAGGCTGGTACGCGACGAACAGCGTGGCGTCTACGGGATGGATCGCTA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Part of the ABC transporter FtsEX involved in cellular division. Has ATPase activity. {ECO:0000250|UniProtKB:A5U7B7, ECO:0000250|UniProtKB:P0A9R7}.

Family

ABC transporter superfamily

GO

transmembrane transporter activity GO:0022857 molecular_function
cell cycle GO:0007049 biological_process
magnesium ion binding GO:0000287 molecular_function
transmembrane transport GO:0055085 biological_process
manganese ion binding GO:0030145 molecular_function
ATP binding GO:0005524 molecular_function
extrinsic component of cytoplasmic side of plasma membrane GO:0031234 cellular_component
plasma membrane GO:0005886 cellular_component
cell division GO:0051301 biological_process
ATPase activity GO:0016887 molecular_function

InterPro

Summary

Name: Cell division ATP-binding protein FtsE
Family: ABC transporter superfamily
Protein Sequence: MMITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDNVAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHIVDSMRQRVVELSLGRLVRDEQRGVYGMDR
Mass: 25,728 Da
Length: 230 Aa

Rv3102c doesn't seem to be a targeted by any drug.

ABC transporters mtu02010
mtu02010
Environmental Information Processing; Membrane transport

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
An M. tuberculosis DNA fragment contains genes encoding cell division proteins ftsX and ftsE, a basic protein and homologues of PemK and small protein B.: Gene. 1996 Oct 24;177(1-2):59-67.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.