sseC1
- Type
- protein_coding
- Name
- sseC1
- Locus Name
-
Rv3118
- Product
-
Conserved hypothetical protein SseC1
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 3484809..3485111 (+ strand)
- Gene Length
- 302 bp
- Nucleotides
-
TGTGCTCTGGACCCAAGCAAGGACTGACATTGCCGGCCAGCGTCGACCTGGAAAAAGAAACGGTGATCACCGGCCGCGTAGTGGACGGTGACGGCCAGGCCGTGGGCGGCGCGTTCGTGCGGCTGCTGGACTCCTCCGACGAGTTCACCGCGGAGGTCGTCGCGTCGGCCACCGGCGATTTCCGGTTCTTCGCCGCGCCCGGATCCTGGACGCTGCGCGCGCTGTCGGCGGCCGGCAACGGCGACGCGGTGGTGCAGCCCTCGGGCGCGGGCATCCACGAGGTAGACGTCAAGATCACCTGA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- neutral lipid metabolic process GO:0006638 biological_process
- acyl-CoA metabolic process GO:0006637 biological_process
- membrane lipid metabolic process GO:0006643 biological_process
- triglyceride mobilization GO:0006642 biological_process
- phospholipid metabolic process GO:0006644 biological_process
- triglyceride metabolic process GO:0006641 biological_process
- monoacylglycerol biosynthetic process GO:0006640 biological_process
- 2-hydroxyquinoline 5,6-dioxygenase activity GO:0018629 molecular_function
- 2-aminobenzenesulfonate 2,3-dioxygenase activity GO:0018627 molecular_function
- terephthalate 1,2-dioxygenase activity GO:0018628 molecular_function
- naphthalene 1,2-dioxygenase activity GO:0018625 molecular_function
- 2-chlorobenzoate 1,2-dioxygenase activity GO:0018626 molecular_function
- NLS-bearing protein import into nucleus GO:0006607 biological_process
- protein import into nucleus GO:0006606 biological_process
- obsolete mRNA-binding (hnRNP) protein import into nucleus GO:0006609 biological_process
- obsolete snRNP protein import into nucleus GO:0006608 biological_process
- phosphocreatine metabolic process GO:0006603 biological_process
- creatinine catabolic process GO:0006602 biological_process
- protein targeting GO:0006605 biological_process
- phosphoarginine metabolic process GO:0006604 biological_process
- ribosomal protein import into nucleus GO:0006610 biological_process
- protein targeting to membrane GO:0006612 biological_process
- protein export from nucleus GO:0006611 biological_process
- creatine biosynthetic process GO:0006601 biological_process
- creatine metabolic process GO:0006600 biological_process
- InterPro
Summary
- Name
- Uncharacterized protein Rv3118
- Family
- Unknown
- Protein Sequence
-
MCSGPKQGLTLPASVDLEKETVITGRVVDGDGQAVGGAFVRLLDSSDEFTAEVVASATGDFRFFAAPGSWTLRALSAAGNGDAVVQPSGAGIHEVDVKIT
- Mass
- 10,165 Da
- Length
- 100 Aa
Rv3118 doesn't seem to be a targeted by any drug.
Rv3118 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected] .
- PLoS One. 2010 Jan 6;5(1):e8589. doi: 10.1371/journal.pone.0008589.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.