moaE1
- Type
- protein_coding
- Name
- moaE1
- Locus Name
-
Rv3119
- Product
-
Probable molybdenum cofactor biosynthesis protein E MoaE1 (molybdopterin converting factor large subunit) (molybdopterin [MPT] converting factor, subunit 2)
- Functional Category
-
Intermediary metabolism and respiration
- Location
- 3485132..3485575 (+ strand)
- Gene Length
- 443 bp
- Nucleotides
-
TGGCCAATGTGGTAGCTGAAGGTGCCTACCCTTACTGTCGGCTCACTGATCAGCCGCTGAGTGTGGACGAAGTGCTAGCCGCCGTCTCGGGCCCCGAACAAGGCGGCATTGTCATATTTGTGGGAAACGTGCGTGACCACAATGCCGGGCATGATGTCACGCGGTTGTTCTACGAGGCGTATCCGCCGATGGTGATTCGGACATTGATGTCGATCATCGGACGGTGTGAAGACAAGGCCGAGGGTGTCCGCGTTGCTGTCGCGCACCGGACCGGTGAATTGCAAATCGGTGATGCCGCGGTCGTTATTGGCGCGTCAGCTCCCCACCGTGCGGAGGCATTTGACGCCGCGCGTATGTGTATCGAGTTGCTTAAGCAGGAAGTGCCGATTTGGAAGAAGGAATTCAGCTCGACCGGTGCTGAATGGGTCGGCGATAGACCATGA
- Drug Resistance
- Mutations
- Function
- Converts molybdopterin precursor Z into molybdopterin. This requires the incorporation of two sulfur atoms into precursor Z to generate a dithiolene group. The sulfur is provided by MoaD (By similarity). {ECO:0000250}.
- Family
-
MoaE family
- GO
-
- molybdopterin cofactor biosynthetic process GO:0032324 biological_process
- molybdopterin synthase activity GO:0030366 molecular_function
- cytosol GO:0005829 cellular_component
- Mo-molybdopterin cofactor biosynthetic process GO:0006777 biological_process
- InterPro
2WP4
- Name
- Molybdopterin synthase catalytic subunit 1 (EC 2.8.1.12) (MPT synthase subunit 2 1) (Molybdenum cofactor biosynthesis protein E 1) (Molybdopterin-converting factor large subunit 1) (Molybdopterin-converting factor subunit 2 1)
- Family
- MoaE family
- Protein Sequence
-
MANVVAEGAYPYCRLTDQPLSVDEVLAAVSGPEQGGIVIFVGNVRDHNAGHDVTRLFYEAYPPMVIRTLMSIIGRCEDKAEGVRVAVAHRTGELQIGDAAVVIGASAPHRAEAFDAARMCIELLKQEVPIWKKEFSSTGAEWVGDRP
- Mass
- 15,920 Da
- Length
- 147 Aa
Summary
Rv3119 doesn't seem to be a targeted by any drug.
-
-
Folate biosynthesis mtu00790
mtu00790PATHWAY_MAP mtu00790 Folate biosynthesis
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.