Gene - combatTB X

tgs1

Type: protein_coding
Name: tgs1
Locus Name: Rv3130c
Product: Triacylglycerol synthase (diacylglycerol acyltransferase) Tgs1
Functional Category: Lipid metabolism
Location: 3494975..3496366 (- strand)
Gene Length: 1391 bp
Nucleotides: ATGAATCACCTAACGACACTTGACGCCGGGTTTCTCAAGGCAGAAGACGTGGATCGGCACGTGAGTCTGGCAATCGGCGCTCTGGCGGTCATCGAGGGGCCGGCTCCCGATCAGGAAGCCTTCTTATCGTCGCTCGCTCAACGCCTACGTCCCTGTACCCGGTTCGGGCAGCGGTTACGCCTGCGCCCGTTCGACCTCGGTGCACCCAAATGGGTGGACGATCCCGACTTCGATCTTGGCCGTCATGTGTGGCGCATCGCCTTGCCGCGGCCTGGCAACGAAGACCAGTTATTCGAGCTGATCGCCGATCTGATGGCGCGTCGTTTGGACCGGGGTCGACCGCTGTGGGAGGTCTGGGTCATCGAAGGCCTGGCGGACAGCAAGTGGGCGATCCTGACCAAACTGCACCACTGCATGGCCGACGGAATCGCGGCGACTCACCTGCTAGCTGGGCTCTCCGATGAAAGTATGAGCGACAGCTTCGCGAGCAACATCCACACGACCATGCAGTCGCAATCCGCATCTGTGCGGCGGGGTGGATTCCGTGTCAATCCAAGCGAGGCGTTGACCGCGTCGACCGCCGTGATGGCAGGCATCGTTCGCGCGGCCAAGGGTGCCAGTGAGATCGCGGCCGGCGTGCTAAGTCCCGCCGCGTCGTCGTTGAACGGGCCGATCAGTGATTTGCGTCGCTACAGCGCAGCAAAGGTCCCTCTCGCCGACGTCGAACAGGTGTGCCGGAAATTCGACGTCACCATCAATGATGTTGCGCTTGCCGCGATTACGGAAAGCTACCGCAACGTCCTCATCCAGCGGGGTGAGCGGCCTAGGTTTGATTCGCTGCGTACGCTAGTGCCGGTCTCGACGCGTTCCAACAGCGCTTTGAGCAAGACCGATAACCGTGTTTCGTTAATGCTGCCCAACCTGCCGGTGGATCAAGAGAACCCGCTGCAGCGGCTGCGGATCGTGCACTCGCGGCTGACTCGGGCCAAGGCGGGGGGACAGAGACAATTCGGAAATACTTTGATGGCGATTGCCAACCGCCTTCCGTTCCCCATGACCGCATGGGCGGTCGGGCTGTTGATGCGGCTGCCGCAGCGTGGTGTTGTCACCGTGGCGACAAATGTGCCGGGTCCACGACGGCCGCTGCAGATTATGGGCAGACGGGTGCTTGACCTATACCCGGTTTCGCCGATCGCGATGCAACTGCGCACCAGTGTCGCGATGCTCAGCTACGCCGACGACCTGTACTTCGGGATCCTGGCCGACTACGACGTGGTAGCAGATGCCGGCCAGCTGGCGCGAGGAATTGAAGACGCCGTCGCACGGCTGGTGGCGATCAGTAAGCGGCGCAAGGTGACTCGCAGGCGCGGAGCGCTATCGCTGGTTGTGTG
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. Required for storage lipid synthesis (Probable). {ECO:0000305|PubMed:15262939}.; FUNCTION: Upon expression in E.coli functions as a triacylglycerol synthase, making triacylglycerol (TG) from diolein and long-chain fatty acyl-CoA. Prefers C(26:0)-CoA over C(18:1)-CoA. TG synthesis activity increases in M.tuberculosis upon oxygen depletion and NO treatment, with concomitant accumulation of TG in inclusion bodies. As disruption of the gene encoding this protein obviates TG synthesis this seems to be the major enzyme involved in production of TG. Has no wax synthase activity to produce wax esters. {ECO:0000269|PubMed:15262939}.

Family

Long-chain O-acyltransferase family

GO

triglyceride biosynthetic process GO:0019432 biological_process
response to nitric oxide GO:0071731 biological_process
growth of symbiont in host cell GO:0044119 biological_process
glycerol metabolic process GO:0006071 biological_process
cell wall GO:0005618 cellular_component
plasma membrane GO:0005886 cellular_component
long-chain-alcohol O-fatty-acyltransferase activity GO:0047196 molecular_function
glycerolipid biosynthetic process GO:0045017 biological_process
response to hypoxia GO:0001666 biological_process
diacylglycerol O-acyltransferase activity GO:0004144 molecular_function

InterPro

UniProt: P9WKC9
GenBank: Rv3130c
EnsemblBacteria: Rv3130c
Mycobrowser: Rv3130c

Summary

Name: Probable diacyglycerol O-acyltransferase tgs1 (TGS1) (EC 2.3.1.20) (Probable triacylglycerol synthase tgs1)
Family: Long-chain O-acyltransferase family
Protein Sequence: MNHLTTLDAGFLKAEDVDRHVSLAIGALAVIEGPAPDQEAFLSSLAQRLRPCTRFGQRLRLRPFDLGAPKWVDDPDFDLGRHVWRIALPRPGNEDQLFELIADLMARRLDRGRPLWEVWVIEGLADSKWAILTKLHHCMADGIAATHLLAGLSDESMSDSFASNIHTTMQSQSASVRRGGFRVNPSEALTASTAVMAGIVRAAKGASEIAAGVLSPAASSLNGPISDLRRYSAAKVPLADVEQVCRKFDVTINDVALAAITESYRNVLIQRGERPRFDSLRTLVPVSTRSNSALSKTDNRVSLMLPNLPVDQENPLQRLRIVHSRLTRAKAGGQRQFGNTLMAIANRLPFPMTAWAVGLLMRLPQRGVVTVATNVPGPRRPLQIMGRRVLDLYPVSPIAMQLRTSVAMLSYADDLYFGILADYDVVADAGQLARGIEDAVARLVAISKRRKVTRRRGALSLVV
Mass: 50,721 Da
Length: 463 Aa

Rv3130c doesn't seem to be a targeted by any drug.

Glycerolipid metabolism mtu00561
mtu00561
PATHWAY_MAP mtu00561 Glycerolipid metabolism

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon.: J Biol Chem. 2008 Jun 27;283(26):18032-9. doi: 10.1074/jbc.M802274200. Epub 2008 Apr 9.
Mycobacterium tuberculosis senses host-derived carbon monoxide during macrophage infection.: Cell Host Microbe. 2008 May 15;3(5):323-30. doi: 10.1016/j.chom.2008.03.007.
Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress.: Microbiology. 2006 Sep;152(Pt 9):2717-25. doi: 10.1099/mic.0.28993-0.
Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture.: J Bacteriol. 2004 Aug;186(15):5017-30. doi: 10.1128/JB.186.15.5017-5030.2004.
Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program.: J Exp Med. 2003 Sep 1;198(5):705-13. doi: 10.1084/jem.20030205.
Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin.: Proc Natl Acad Sci U S A. 2001 Jun 19;98(13):7534-9. doi: 10.1073/pnas.121172498.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
Massive gene duplication event among clinical isolates of the Mycobacterium tuberculosis W/Beijing family.: J Bacteriol. 2010 Sep;192(18):4562-70. doi: 10.1128/JB.00536-10. Epub 2010 Jul 16.