Rv3143
- Type
- protein_coding
- Name
- Rv3143
- Locus Name
-
Rv3143
- Product
-
Probable response regulator
- Functional Category
-
Regulatory proteins
- Location
- 3509654..3510055 (+ strand)
- Gene Length
- 401 bp
- Nucleotides
-
TGCCCGACTCCAGCACCGCATTGCGGATCCTCGTCTACAGCGACAACGTCCAGACCCGCGAACGGGTGATGCGGGCCCTGGGCAAACGGTTGCACCCGGATCTGCCCGATTTGACCTACGTCGAAGTGGCTACCGGTCCGATGGTGATACGCCAGATGGATCGGGGGGGCATCGACTTGGCCATCCTCGACGGTGAGGCGACACCGACCGGAGGCATGGGAATCGCCAAACAGCTCAAAGACGAACTTGCCAGTTGCCCGCCCATCCTGGTGCTCACCGGCCGTCCGGACGACACCTGGCTGGCCAGCTGGTCGCGGGCCGAGGCCGCAGTGCCGCATCCCGTCGACCCCATCGTGCTGGGCCGCACGGTGCTCTCACTGTTGCGCGCACCCGCCCACTAA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Unknown
- GO
-
- cell wall GO:0005618 cellular_component
- phosphorelay signal transduction system GO:0000160 biological_process
- InterPro
Summary
- Name
- Uncharacterized response regulatory protein Rv3143
- Family
- Unknown
- Protein Sequence
-
MPDSSTALRILVYSDNVQTRERVMRALGKRLHPDLPDLTYVEVATGPMVIRQMDRGGIDLAILDGEATPTGGMGIAKQLKDELASCPPILVLTGRPDDTWLASWSRAEAAVPHPVDPIVLGRTVLSLLRAPAH
- Mass
- 14,386 Da
- Length
- 133 Aa
Rv3143 doesn't seem to be a targeted by any drug.
Rv3143 doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Experimental determination of translational starts using peptide mass mapping and tandem mass spectrometry within the proteome of Mycobacterium tuberculosis.
- Microbiology. 2007 Feb;153(Pt 2):521-8. doi: 10.1099/mic.0.2006/001537-0.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.