Gene - combatTB X

sigH

Type: protein_coding
Name: sigH
Locus Name: Rv3223c
Product: Alternative RNA polymerase sigma-E factor (sigma-24) SigH (RPOE)
Functional Category: Information pathways
Location: 3598901..3599551 (- strand)
Gene Length: 650 bp
Nucleotides: ATGGCCGACATCGATGGTGTAACCGGTTCGGCGGGTCTGCAGCCTGGGCCGTCTGAGGAGACAGACGAGGAGTTGACCGCGCGTTTCGAGCGCGACGCGATTCCCCTGTTGGACCAGCTGTACGGCGGTGCGCTGCGGATGACGCGCAATCCGGCCGACGCCGAGGACTTGCTCCAGGAGACGATGGTGAAGGCCTATGCGGGATTTCGTTCGTTCCGGCACGGTACCAATCTCAAGGCCTGGCTCTACCGGATACTGACCAACACCTACATCAACAGCTATCGCAAGAAACAGCGGCAACCGGCGGAGTATCCGACCGAGCAGATCACCGATTGGCAACTGGCGTCCAACGCCGAGCATTCCTCGACCGGGCTGCGCTCGGCTGAAGTCGAAGCGTTAGAAGCGTTGCCGGACACCGAGATCAAAGAGGCGCTGCAGGCATTGCCGGAAGAGTTCCGGATGGCGGTCTACTACGCCGATGTCGAAGGTTTCCCCTACAAGGAGATCGCCGAGATCATGGATACTCCGATCGGCACCGTGATGTCGAGGCTTCATCGCGGCCGACGTCAGTTGCGCGGTCTTTTAGCCGATGTGGCCAGGGATCGGGGGTTTGCCAGGGGCGAGCAGGCGCACGAGGGGGTGTCGTCATG
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Extracytoplasmic function (ECF) sigma factors are held in an inactive form by a cognate anti-sigma factor (RshA) until released. This sigma factor is involved in heat shock and oxidative stress responses; it positively regulates the expression of itself, sigE, sigB and a number of transcriptional regulators as well as other effectors of heat and oxidative stress, leading to direct and indirect control of up to 25% of the bacterial genome. Modulates expression of host genes for intercrine beta (chemokine CC) and apoptosis, altering the host immune response. {ECO:0000269|PubMed:11567012, ECO:0000269|PubMed:12123450, ECO:0000269|PubMed:14617153, ECO:0000269|PubMed:16298337}.

Family

Sigma-70 factor family, ECF subfamily

GO

response to heat GO:0009408 biological_process
cellular response to heat GO:0034605 biological_process
DNA-binding transcription factor activity GO:0003700 molecular_function
cell wall GO:0005618 cellular_component
DNA binding GO:0003677 molecular_function
DNA-templated transcription, initiation GO:0006352 biological_process
response to oxidative stress GO:0006979 biological_process
sigma factor activity GO:0016987 molecular_function
response to nitrosative stress GO:0051409 biological_process
regulation of transcription, DNA-templated GO:0006355 biological_process

InterPro

UniProt: P9WGH9
GenBank: Rv3223c
EnsemblBacteria: Rv3223c
Mycobrowser: Rv3223c

Summary

Name: ECF RNA polymerase sigma factor SigH (ECF sigma factor SigH) (Alternative RNA polymerase sigma factor SigH) (RNA polymerase sigma-H factor) (Sigma-H factor)
Family: Sigma-70 factor family, ECF subfamily
Protein Sequence: MADIDGVTGSAGLQPGPSEETDEELTARFERDAIPLLDQLYGGALRMTRNPADAEDLLQETMVKAYAGFRSFRHGTNLKAWLYRILTNTYINSYRKKQRQPAEYPTEQITDWQLASNAEHSSTGLRSAEVEALEALPDTEIKEALQALPEEFRMAVYYADVEGFPYKEIAEIMDTPIGTVMSRLHRGRRQLRGLLADVARDRGFARGEQAHEGVSS
Mass: 24,225 Da
Length: 216 Aa

Rv3223c doesn't seem to be a targeted by any drug.

Rv3223c doesn't seem to be involved in any pathway.

Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis.: Proc Natl Acad Sci U S A. 2008 Sep 2;105(35):13105-10. doi: 10.1073/pnas.0801143105. Epub 2008 Aug 26.
targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.: BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
RshA mimetic peptides inhibiting the transcription driven by a Mycobacterium tuberculosis sigma factor SigH.: Biochem Biophys Res Commun. 2006 Jan 6;339(1):392-8. doi: 10.1016/j.bbrc.2005.11.032. Epub 2005 Nov 14.
RshA, an anti-sigma factor that regulates the activity of the mycobacterial stress response sigma factor SigH.: Mol Microbiol. 2003 Nov;50(3):949-59.
Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression.: Mol Microbiol. 2002 Jul;45(2):365-74.
The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis.: J Bacteriol. 2001 Oct;183(20):6119-25. doi: 10.1128/JB.183.20.6119-6125.2001.
Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis.: Mol Microbiol. 1999 Jan;31(2):715-24.
Interaction of Mycobacterium tuberculosis RshA and SigH is mediated by salt bridges.: PLoS One. 2012;7(8):e43676. doi: 10.1371/journal.pone.0043676. Epub 2012 Aug 24.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.