Gene - combatTB X

sigF

Type: protein_coding
Name: sigF
Locus Name: Rv3286c
Product: Alternative RNA polymerase sigma factor SigF
Functional Category: Information pathways
Location: 3668169..3668954 (- strand)
Gene Length: 785 bp
Nucleotides: GTGACGGCGCGCGCTGCCGGCGGTTCTGCATCGCGAGCTAACGAATACGCCGACGTTCCGGAGATGTTTCGCGAGCTGGTTGGTTTGCCTGCCGGCTCACCGGAATTCCAGCGGCACCGGGACAAGATCGTTCAGCGGTGCTTGCCGCTGGCCGATCACATCGCGCGGCGGTTCGAGGGTCGCGGCGAACCGCGTGACGACCTTATTCAGGTCGCGCGGGTCGGGCTGGTCAACGCCGCGGTTCGCTTCGACGTGAAGACCGGGTCGGACTTCGTCTCCTTCGCGGTTCCTACCATCATGGGCGAGGTCCGACGACACTTCCGCGACAACAGCTGGTCGGTCAAGGTTCCCCGGCGTCTCAAGGAACTGCATCTGCGGCTAGGTACCGCCACCGCCGATTTGTCGCAGCGGCTCGGGCGGGCGCCGTCGGCATCGGAGCTCGCCGCGGAGCTCGGGATGGACCGCGCTGAGGTTATCGAAGGTTTGCTGGCGGGTAGTTCCTACCACACCTTGTCCATCGACAGCGGTGGCGGCAGCGACGACGATGCCCGCGCAATCACAGACACCCTGGGCGACGTGGATGCGGGTCTTGACCAGATCGAGAATCGGGAGGTGCTTCGTCCGTTGCTCGAGGCGTTGCCCGAGCGGGAACGAACGGTCTTGGTGCTCAGGTTCTTCGACTCGATGACCCAAACGCAGATCGCCGAGCGCGTCGGTATCTCACAGATGCACGTGTCGCGGCTGCTGGCCAAGTCATTGGCACGGCTACGGGATCAGTTGGAGTA
Drug Resistance: Check for drug resistance association at TBDREAMDB
Mutations: Check for mutants available at TARGET

Function

Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. Held in an inactive form by a cognate anti-sigma factor RsbW (UsfX) until released. Increased expression decreases growth rate, and after 3 days increases the expression of 51 loci encoding 33 protein-coding genes as well as some non-coding RNA (PubMed:22307756). {ECO:0000269|PubMed:12354223, ECO:0000269|PubMed:20729364, ECO:0000269|PubMed:22307756, ECO:0000269|PubMed:22570422}.

Family

Sigma-70 factor family

GO

response to cold GO:0009409 biological_process
response to antibiotic GO:0046677 biological_process
response to anoxia GO:0034059 biological_process
DNA-binding transcription factor activity GO:0003700 molecular_function
DNA binding GO:0003677 molecular_function
positive regulation of transcription, DNA-templated GO:0045893 biological_process
DNA-templated transcription, initiation GO:0006352 biological_process
RNA polymerase core enzyme binding GO:0043175 molecular_function
cellular response to cold GO:0070417 biological_process
sigma factor activity GO:0016987 molecular_function
cellular response to nitrogen starvation GO:0006995 biological_process
response to oxidative stress GO:0006979 biological_process
lipid metabolic process GO:0006629 biological_process

InterPro

UniProt: P9WGI3
GenBank: Rv3286c
EnsemblBacteria: Rv3286c
Mycobrowser: Rv3286c

Summary

Name: RNA polymerase sigma factor SigF (Sigma factor SigF) (Alternative RNA polymerase sigma factor SigF) (RNA polymerase sigma-F factor) (Sigma-F factor) (Stress response/stationary phase sigma factor SigF)
Family: Sigma-70 factor family
Protein Sequence: MTARAAGGSASRANEYADVPEMFRELVGLPAGSPEFQRHRDKIVQRCLPLADHIARRFEGRGEPRDDLIQVARVGLVNAAVRFDVKTGSDFVSFAVPTIMGEVRRHFRDNSWSVKVPRRLKELHLRLGTATADLSQRLGRAPSASELAAELGMDRAEVIEGLLAGSSYHTLSIDSGGGSDDDARAITDTLGDVDAGLDQIENREVLRPLLEALPERERTVLVLRFFDSMTQTQIAERVGISQMHVSRLLAKSLARLRDQLE
Mass: 28,794 Da
Length: 261 Aa

Rv3286c doesn't seem to be a targeted by any drug.

Rv3286c doesn't seem to be involved in any pathway.

Mycobacterium tuberculosis RbpA protein is a new type of transcriptional activator that stabilizes the sigma A-containing RNA polymerase holoenzyme.: Nucleic Acids Res. 2012 Aug;40(14):6547-57. doi: 10.1093/nar/gks346. Epub 2012 May 8.
Genome-wide definition of the SigF regulon in Mycobacterium tuberculosis.: J Bacteriol. 2012 Apr;194(8):2001-9. doi: 10.1128/JB.06692-11. Epub 2012 Feb 3.
Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.: Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
Over-expression and purification strategies for recombinant multi-protein oligomers: a case study of Mycobacterium tuberculosis sigma/anti-sigma factor protein complexes.: Protein Expr Purif. 2010 Dec;74(2):223-30. doi: 10.1016/j.pep.2010.06.018. Epub 2010 Jul 1.
Sigma factor F does not prevent rifampin inhibition of RNA polymerase or cause rifampin tolerance in Mycobacterium tuberculosis.: J Bacteriol. 2010 Oct;192(20):5472-9. doi: 10.1128/JB.00687-10. Epub 2010 Aug 20.
Interactions of the M. tuberculosis UsfX with the cognate sigma factor SigF and the anti-anti sigma factor RsfA.: Biochim Biophys Acta. 2009 Mar;1794(3):541-53. doi: 10.1016/j.bbapap.2008.11.007. Epub 2008 Nov 27.
Examination of Mycobacterium tuberculosis sigma factor mutants using low-dose aerosol infection of guinea pigs suggests a role for SigC in pathogenesis.: Microbiology. 2006 Jun;152(Pt 6):1591-600. doi: 10.1099/mic.0.28591-0.
Novel Mycobacterium tuberculosis anti-sigma factor antagonists control sigmaF activity by distinct mechanisms.: Mol Microbiol. 2002 Sep;45(6):1527-40.
Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling.: Mol Microbiol. 2002 Feb;43(3):717-31.
Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis.: Mol Microbiol. 1999 Jan;31(2):715-24.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.: Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
A stationary-phase stress-response sigma factor from Mycobacterium tuberculosis.: Proc Natl Acad Sci U S A. 1996 Apr 2;93(7):2790-4. doi: 10.1073/pnas.93.7.2790.