relJ
- Type
- protein_coding
- Name
- relJ
- Locus Name
-
Rv3357
- Product
-
Antitoxin RelJ
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 3770773..3771048 (+ strand)
- Gene Length
- 275 bp
- Nucleotides
-
TGAGCATCAGTGCGAGCGAGGCGAGGCAGCGCCTGTTTCCACTCATCGAACAGGTCAATACCGATCACCAGCCGGTGCGGATCACCTCCCGGGCCGGCGATGCGGTGCTGATGTCCGCCGACGACTACGACGCGTGGCAGGAAACGGTCTATCTGCTGCGCTCACCGGAGAACGCCAGGCGGTTGATGGAAGCGGTTGCCCGGGATAAGGCTGGGCACTCGGCTTTCACCAAGTCTGTAGATGAGCTGCGGGAGATGGCCGGCGGCGAGGAGTGA
- Drug Resistance
- Mutations
- Function
- Antitoxin component of a type II toxin-antitoxin (TA) system. A probable antitoxin for the putative mRNA interferase RelK. Upon expression in E.coli but not in M.smegmatis this protein neutralizes E.coli YoeB.; FUNCTION: Binds to and represses its own promoter, in combination with RelK repression is somewhat lessened. Several DNA-protein complexes are formed in vitro depending on the RelJ:RelK ratio.
- Family
-
PhD/YefM antitoxin family
- GO
-
- regulation of transcription, DNA-templated GO:0006355 biological_process
- DNA binding GO:0003677 molecular_function
- InterPro
3CTO
- Name
- Antitoxin RelJ (Antitoxin YefM)
- Family
- PhD/YefM antitoxin family
- Protein Sequence
-
MSISASEARQRLFPLIEQVNTDHQPVRITSRAGDAVLMSADDYDAWQETVYLLRSPENARRLMEAVARDKAGHSAFTKSVDELREMAGGEE
- Mass
- 10,194 Da
- Length
- 91 Aa
Summary
Rv3357 doesn't seem to be a targeted by any drug.
Rv3357 doesn't seem to be involved in any pathway.
- Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein.
- J Mol Biol. 2008 Nov 14;383(3):482-93. doi: 10.1016/j.jmb.2008.08.067. Epub 2008 Sep 4.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules.
- PLoS One. 2010 May 17;5(5):e10672. doi: 10.1371/journal.pone.0010672.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Three Mycobacterium tuberculosis Rel toxin-antitoxin modules inhibit mycobacterial growth and are expressed in infected human macrophages.
- J Bacteriol. 2009 Mar;191(5):1618-30. doi: 10.1128/JB.01318-08. Epub 2008 Dec 29.
- Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution.
- PLoS Genet. 2009 Dec;5(12):e1000767. doi: 10.1371/journal.pgen.1000767. Epub 2009 Dec 11.