Rv3405c
- Type
- protein_coding
- Name
- Rv3405c
- Locus Name
-
Rv3405c
- Product
-
Possible transcriptional regulatory protein
- Functional Category
-
Regulatory proteins
- Location
- 3824702..3825268 (- strand)
- Gene Length
- 566 bp
- Nucleotides
-
ATGACTACGCGTCCGGCAACCGACCGCCGCAAGATGCCCACTGGGCGGGAAGAGGTAGCGGCCGCAATCCTGCAGGCCGCCACCGACCTGTTCGCCGAGCGTGGGCCAGCCGCGACGTCGATTCGCGACATCGCCGCTCGATCCAAGGTCAACCACGGGCTGGTGTTTCGTCACTTCGGCACCAAGGACCAACTGGTTGGGGCCGTGCTCGATCACCTGGGCACGAAGCTGACCAGACTGTTGCACTCCGAGGCGCCCGCTGACATCATCGAACGGGCTCTCGACCGACATGGGCGGGTCTTAGCCCGGGCACTGCTGGACGGATATCCCGTGGGCCAGCTGCAACAGCGATTTCCCAATGTTGCGGAGCTGCTCGACGCGGTACGGCCTCGCTACGACAGCGACTTGGGCGCGCGGCTGGCGGTCGCGCACGCCCTTGCGCTGCAATTCGGTTGGCGGCTCTTTGCGCCCATGCTGCGCTCGGCGACGGGTATCGACGAGCTGACCGGTGACGAACTACGGCTGTCCGTGAACGATGCGGTAGCCCGGATCCTGGAACCGCACTG
- Drug Resistance
- Mutations
- Function
- Negatively regulates the expression of sulfate ester dioxygenase Rv3406 and its own expression (PubMed:25427196, PubMed:29395080). Binds specifically to the inverted repeat sequence of the intergenic region between Rv3405c and Rv3406 (PubMed:29395080). {ECO:0000269|PubMed:25427196, ECO:0000269|PubMed:29395080}.
- Family
-
Unknown
- GO
-
- DNA binding GO:0003677 molecular_function
- InterPro
Summary
- Name
- HTH-type transcriptional repressor Rv3405c
- Family
- Unknown
- Protein Sequence
-
MTTRPATDRRKMPTGREEVAAAILQAATDLFAERGPAATSIRDIAARSKVNHGLVFRHFGTKDQLVGAVLDHLGTKLTRLLHSEAPADIIERALDRHGRVLARALLDGYPVGQLQQRFPNVAELLDAVRPRYDSDLGARLAVAHALALQFGWRLFAPMLRSATGIDELTGDELRLSVNDAVARILEPH
- Mass
- 20,609 Da
- Length
- 188 Aa
Rv3405c doesn't seem to be a targeted by any drug.
Rv3405c doesn't seem to be involved in any pathway.
- Biophysical and biochemical characterization of Rv3405c, a tetracycline repressor protein from Mycobacterium tuberculosis.
- Biochem Biophys Res Commun. 2018 Feb 12;496(3):799-805. doi: 10.1016/j.bbrc.2018.01.152.
- 2-Carboxyquinoxalines kill mycobacterium tuberculosis through noncovalent inhibition of DprE1.
- ACS Chem Biol. 2015 Mar 20;10(3):705-14. doi: 10.1021/cb5007163. Epub 2014 Dec 9.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- targetTB: a target identification pipeline for Mycobacterium tuberculosis through an interactome, reactome and genome-scale structural analysis.
- BMC Syst Biol. 2008 Dec 19;2:109. doi: 10.1186/1752-0509-2-109.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.