whiB3



Type
protein_coding
Name
whiB3
Locus Name

Rv3416

Product

Transcriptional regulatory protein WhiB-like WhiB3. Contains [4FE-4S] cluster.

Functional Category

Regulatory proteins

Location
3834892..3835200 (+ strand)
Gene Length
308 bp
Nucleotides
TGCCACAGCCGGAGCAGCTACCGGGACCCAACGCAGACATCTGGAACTGGCAATTGCAAGGCCTGTGTCGCGGCATGGACTCATCGATGTTCTTCCATCCCGACGGCGAGCGTGGCCGTGCCCGAACGCAGCGCGAACAACGCGCCAAGGAAATGTGTCGGCGCTGCCCCGTGATCGAGGCGTGCCGATCCCATGCGTTAGAGGTCGGTGAGCCCTATGGCGTTTGGGGTGGCCTGTCCGAATCCGAGCGCGACCTACTCCTCAAGGGCACCATGGGACGCACCCGCGGCATCCGCCGCACAGCTTAA
Drug Resistance

Check for drug resistance association at TBDREAMDB

Mutations

Check for mutants available at TARGET


Function
A redox-sensitive transcriptional regulator. Maintains intracellular redox homeostasis by regulating catabolic metabolism and polyketide biosynthesis (PubMed:17609386, PubMed:19680450). Regulates expression of the redox buffer ergothioneine (ERG) in a carbon-source-dependent manner; loss of ERG or mycothiol (MSH, the other major redox buffer in this bacteria) leads to respiratory alterations and bioenergetic deficiencies that negatively impact virulence (PubMed:26774486). In response to low external pH (like that found in host macrophage phagosomes) alters endogenous gene expression leading to acid resistance; MSH and WhiB3 are probably part of a regulatory circuit that mediates gene expression upon acid stress (PubMed:26637353). Regulates pathogenic lipid synthesis, coordinating proprionate flux (and other host-derived fatty acid oxidation intermediates) into methyl-branched fatty acids (polyacyltrehalose, phthiocerol dimycocerosates, sulfolipids) and the storage lipid triacylglycerol, functioning as reductive sink (PubMed:19680450). During intracellular growth M.tuberculosis uses host fatty acids as an energy source, generating large quantities of proprionate and NADH/NADPH, which are toxic and highly reducing respectively. WhiB3 is thought to help dissipate proprionate and NADH/NADPH by switching to the in vivo carbon source and via lipid anabolism (PubMed:19680450). Responds to NO and O(2) (PubMed:17609386). Regulates expression of genes encoding modular polyketide synthases such as pks2, pks3 and fbpA (PubMed:19680450). The oxidized apo-form of WhiB3 binds DNA (with 2 intramolecular disulfide bonds); holo-WhiB3 (with the 4Fe-4S cluster) binds DNA considerably less well (PubMed:19680450). Discriminates poorly between specific and non-specific DNA-binding. Plays a role in virulence and nutritional stress (PubMed:11880648, PubMed:17609386, PubMed:26637353). In its apo-form can act as a protein disulfide reductase (PubMed:18550384). {ECO:0000269|PubMed:11880648, ECO:0000269|PubMed:17609386, ECO:0000269|PubMed:18550384, ECO:0000269|PubMed:19016840, ECO:0000269|PubMed:19680450, ECO:0000269|PubMed:26637353, ECO:0000269|PubMed:26774486}.; FUNCTION: May respond to mycothiol (MSH) redox potential (E-MSH) which decreases at pH 4.5 for up to 72 hours, indicative of cellular reductive stress; deletion of whiB3 leads to a lesser E-MSH at 72 hours, indicative of cellular oxidative stress (PubMed:26637353). Probably via its effects on production of polyketide lipids, regulates host gene expression, leading to blockage of phagosome maturation (PubMed:26637353). Equilibration of extra- and intracytoplasmic pH kills bacteria (PubMed:26637353). {ECO:0000269|PubMed:26637353}.
Family

WhiB family

GO
InterPro

UniProt
P9WF41
GenBank
Rv3416
EnsemblBacteria
Rv3416
Mycobrowser
Rv3416


Summary
Name
Redox- and pH-responsive transcriptional regulator WhiB3
Family
WhiB family
Protein Sequence
MPQPEQLPGPNADIWNWQLQGLCRGMDSSMFFHPDGERGRARTQREQRAKEMCRRCPVIEACRSHALEVGEPYGVWGGLSESERDLLLKGTMGRTRGIRRTA
Mass
11,612 Da
Length
102 Aa

Rv3416 doesn't seem to be a targeted by any drug.


Rv3416 doesn't seem to be involved in any pathway.


Mycobacterium tuberculosis WhiB3: a novel iron-sulfur cluster protein that regulates redox homeostasis and virulence.
Antioxid Redox Signal. 2012 Apr 1;16(7):687-97. doi: 10.1089/ars.2011.4341.
Mycobacterium tuberculosis WhiB3 Responds to Vacuolar pH-induced Changes in Mycothiol Redox Potential to Modulate Phagosomal Maturation and Virulence.
J Biol Chem. 2016 Feb 5;291(6):2888-903. doi: 10.1074/jbc.M115.684597. Epub 2015 Dec 4.
Ergothioneine Maintains Redox and Bioenergetic Homeostasis Essential for Drug Susceptibility and Virulence of Mycobacterium tuberculosis.
Cell Rep. 2016 Jan 26;14(3):572-585. doi: 10.1016/j.celrep.2015.12.056. Epub 2016 Jan 7.
Studies on structural and functional divergence among seven WhiB proteins of Mycobacterium tuberculosis H37Rv.
FEBS J. 2009 Jan;276(1):76-93. doi: 10.1111/j.1742-4658.2008.06755.x.
Mycobacterium tuberculosis WhiB3 maintains redox homeostasis by regulating virulence lipid anabolism to modulate macrophage response.
PLoS Pathog. 2009 Aug;5(8):e1000545. doi: 10.1371/journal.ppat.1000545. Epub 2009 Aug 14.
Matrix-assisted refolding and redox properties of WhiB3/Rv3416 of Mycobacterium tuberculosis H37Rv.
Protein Expr Purif. 2008 Sep;61(1):83-91. doi: 10.1016/j.pep.2008.04.010. Epub 2008 May 9.
Mycobacterium tuberculosis WhiB3 responds to O2 and nitric oxide via its [4Fe-4S] cluster and is essential for nutrient starvation survival.
Proc Natl Acad Sci U S A. 2007 Jul 10;104(28):11562-7. doi: 10.1073/pnas.0700490104. Epub 2007 Jul 3.
Regulation of Mycobacterium tuberculosis whiB3 in the mouse lung and macrophages.
Infect Immun. 2006 Nov;74(11):6449-57. doi: 10.1128/IAI.00190-06. Epub 2006 Aug 21.
Mycobacterium tuberculosis WhiB3 interacts with RpoV to affect host survival but is dispensable for in vivo growth.
Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):3147-52. doi: 10.1073/pnas.052705399.
Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.