groES
- Type
- protein_coding
- Name
- groES
- Locus Name
-
Rv3418c
- Product
-
10 kDa chaperonin GroES (protein CPN10) (protein GroES) (BCG-a heat shock protein) (10 kDa antigen)
- Functional Category
-
Virulence, detoxification, adaptation
- Location
- 3836986..3837288 (- strand)
- Gene Length
- 302 bp
- Nucleotides
-
GTGGCGAAGGTGAACATCAAGCCACTCGAGGACAAGATTCTCGTGCAGGCCAACGAGGCCGAGACCACGACCGCGTCCGGTCTGGTCATTCCTGACACCGCCAAGGAGAAGCCGCAGGAGGGCACCGTCGTTGCCGTCGGCCCTGGCCGGTGGGACGAGGACGGCGAGAAGCGGATCCCGCTGGACGTTGCGGAGGGTGACACCGTCATCTACAGCAAGTACGGCGGCACCGAGATCAAGTACAACGGCGAGGAATACCTGATCCTGTCGGCACGCGACGTGCTGGCCGTCGTTTCCAAGTA
- Drug Resistance
- Mutations
- Function
- Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.
- Family
-
GroES chaperonin family
- GO
-
- metal ion binding GO:0046872 molecular_function
- response to heat GO:0009408 biological_process
- response to antibiotic GO:0046677 biological_process
- cellular response to heat GO:0034605 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- ATP binding GO:0005524 molecular_function
- cytosol GO:0005829 cellular_component
- regulation of transcription, DNA-templated GO:0006355 biological_process
- plasma membrane GO:0005886 cellular_component
- zymogen binding GO:0035375 molecular_function
- chaperone binding GO:0051087 molecular_function
- unfolded protein binding GO:0051082 molecular_function
- chaperone cofactor-dependent protein refolding GO:0051085 biological_process
- InterPro
1HX5
- Name
- 10 kDa chaperonin (10 kDa antigen) (BCG-A heat shock protein) (GroES protein) (Protein Cpn10)
- Family
- GroES chaperonin family
- Protein Sequence
-
MAKVNIKPLEDKILVQANEAETTTASGLVIPDTAKEKPQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTEIKYNGEEYLILSARDVLAVVSK
- Mass
- 10,804 Da
- Length
- 100 Aa
Summary
Rv3418c doesn't seem to be a targeted by any drug.
Rv3418c doesn't seem to be involved in any pathway.
- Mycobacterium tuberculosis chaperonin 10 heptamers self-associate through their biologically active loops.
- J Bacteriol. 2003 Jul;185(14):4172-85. doi: 10.1128/jb.185.14.4172-4185.2003.
- Biochemical evidence for relaxed substrate specificity of Nalpha-acetyltransferase (Rv3420c/rimI) of Mycobacterium tuberculosis.
- Sci Rep. 2016 Jun 29;6:28892. doi: 10.1038/srep28892.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Prokaryotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis [corrected] .
- PLoS One. 2010 Jan 6;5(1):e8589. doi: 10.1371/journal.pone.0008589.
- A Mycobacterium tuberculosis mutant lacking the groEL homologue cpn60.1 is viable but fails to induce an inflammatory response in animal models of infection.
- Infect Immun. 2008 Apr;76(4):1535-46. doi: 10.1128/IAI.01078-07. Epub 2008 Jan 28.
- Immunoreactivity of a 10-kDa antigen of Mycobacterium tuberculosis.
- J Immunol. 1992 Mar 15;148(6):1835-40.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.
- Mycobacterium tuberculosis expresses two chaperonin-60 homologs.
- Proc Natl Acad Sci U S A. 1993 Apr 1;90(7):2608-12. doi: 10.1073/pnas.90.7.2608.
- The Mycobacterium tuberculosis BCG-a protein has homology with the Escherichia coli GroES protein.
- Nucleic Acids Res. 1989 Feb 11;17(3):1254. doi: 10.1093/nar/17.3.1254.
- Cloning and sequence analysis of the 10 kDa antigen gene of Mycobacterium tuberculosis.
- J Gen Microbiol. 1989 Apr;135(4):931-9. doi: 10.1099/00221287-135-4-931.
- A major antigen from Mycobacterium tuberculosis which is homologous to the heat shock proteins groES from E. coli and the htpA gene product of Coxiella burneti.
- Nucleic Acids Res. 1988 Sep 26;16(18):9047. doi: 10.1093/nar/16.18.9047.