Rv3422c
- Type
- protein_coding
- Name
- Rv3422c
- Locus Name
-
Rv3422c
- Product
-
Conserved hypothetical protein
- Functional Category
-
Conserved hypotheticals
- Location
- 3839691..3840197 (- strand)
- Gene Length
- 506 bp
- Nucleotides
-
TTGAGCCGTGAGGGTATCCGCAGACGACCGAAAGCCAGGGCTGGGCTTACGGGCGGCGGCACGGCGACGCTGCCGCGCGTCGAGGACACCCTAACGCTGGGGTCCCGGCTGGGTGAGCAGCTGTGCGCTGGCGACGTGGTGGTGCTCTCCGGTCCGCTCGGTGCGGGAAAGACGGTGCTGGCCAAGGGTATTGCCATGGCGATGGATGTCGAGGGGCCGATCACATCGCCGACGTTCGTGCTGGCGCGAATGCACCGGCCGCGGCGGCCGGGCACGCCGGCGATGGTCCACGTCGACGTCTACCGACTGCTGGACCACAACAGCGCCGACCTGCTGAGTGAGCTGGACTCACTGGACCTCGACACCGATCTTGAAGACGCCGTCGTCGTGGTGGAGTGGGGCGAGGGCCTGGCCGAGCGGCTCTCGCAGCGCCACCTCGACGTCCGCCTGGAGCGGGTTAGCCACTCCGACACCAGGATCGCGACTTGGTCGTGGGGCCGGTCATG
- Drug Resistance
- Mutations
- Function
- Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37, together with TsaD and TsaB. TsaE seems to play an indirect role in the t(6)A biosynthesis pathway, possibly in regulating the core enzymatic function of TsaD (By similarity). {ECO:0000250}.
- Family
-
TsaE family
- GO
-
- metal ion binding GO:0046872 molecular_function
- tRNA threonylcarbamoyladenosine modification GO:0002949 biological_process
- ATP binding GO:0005524 molecular_function
- cytoplasm GO:0005737 cellular_component
- InterPro
Summary
- Name
- tRNA threonylcarbamoyladenosine biosynthesis protein TsaE (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaE)
- Family
- TsaE family
- Protein Sequence
-
MSREGIRRRPKARAGLTGGGTATLPRVEDTLTLGSRLGEQLCAGDVVVLSGPLGAGKTVLAKGIAMAMDVEGPITSPTFVLARMHRPRRPGTPAMVHVDVYRLLDHNSADLLSELDSLDLDTDLEDAVVVVEWGEGLAERLSQRHLDVRLERVSHSDTRIATWSWGRS
- Mass
- 18,214 Da
- Length
- 168 Aa
Rv3422c doesn't seem to be a targeted by any drug.
Rv3422c doesn't seem to be involved in any pathway.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.