PPE57
- Type
- protein_coding
- Name
- PPE57
- Locus Name
-
Rv3425
- Product
-
PPE family protein PPE57
- Functional Category
-
Pe/ppe
- Location
- 3842239..3842769 (+ strand)
- Gene Length
- 530 bp
- Nucleotides
-
TGCATCCAATGATACCAGCGGAGTATATCTCCAACATAATATATGAAGGCCCGGGCGCTGACTCATTGTTTTTCGCCTCCGGGCAATTGCGAGAATTGGCTTACTCAGTTGAAACGACGGCTGAGTCGCTCGAGGACGAGCTCGACGAGCTGGATGAGAACTGGAAAGGTAGTTCGTCGGACTTGTTGGCCGACGCGGTTGAGCGGTATCTCCAATGGCTGTCTAAACACTCCAGTCAGCTTAAGCATGCCGCCTGGGTGATCAACGGCCTCGCGAACGCCTATAACGACACACGTCGGAAGGTGGTACCCCCGGAGGAGATCGCCGCCAACCGCGAGGAGAGGCGCAGGCTGATCGCGAGCAACGTGGCCGGGGTAAACACTCCAGCAATCGCAGACCTCGATGCACAATACGACCAGTACCGGGCCCGCAATGTCGCTGTAATGAACGCCTATGTAAGTTGGACCCGATCTGCGCTATCGGATCTGCCCCGGTGGCGGGAACCGCCGCAGATCTACAGGGGCGGGTAG
- Drug Resistance
- Mutations
- Function
- Plays a key role in regulating innate and adaptive immune responses through human Toll-like receptor 2 (TLR2). Interacts with TLR2, leading to the subsequent activation of the mitogen-activated protein kinase (MAPK) and nuclear factor kappa B (NF-kappa-B) signaling pathways. Induces macrophage activation by augmenting the expression of several cell surface molecules (CD40, CD80, CD86 and MHC class II) and pro-inflammatory cytokines (TNF-alpha, IL-6 and IL-12p40) within macrophages. Also participates in adaptive immunity by directing Th1-polarised immune responses (PubMed:25586105). Stimulates specific humoral and cellular immune responses in tuberculosis (TB) patients (PubMed:17328725, PubMed:19467342, PubMed:23136116). Induces a strong IgG(1) antibody response and an increased Th1/Th2 type immune response in mice (PubMed:18426397). {ECO:0000269|PubMed:17328725, ECO:0000269|PubMed:18426397, ECO:0000269|PubMed:19467342, ECO:0000269|PubMed:23136116, ECO:0000269|PubMed:25586105}.
- Family
-
Mycobacterial PPE family
- GO
-
- cell surface GO:0009986 cellular_component
- pathogenesis GO:0009405 biological_process
- cell wall GO:0005618 cellular_component
- extracellular region GO:0005576 cellular_component
- InterPro
Summary
- Name
- PPE family protein PPE57
- Family
- Mycobacterial PPE family
- Protein Sequence
-
MHPMIPAEYISNIIYEGPGADSLFFASGQLRELAYSVETTAESLEDELDELDENWKGSSSDLLADAVERYLQWLSKHSSQLKHAAWVINGLANAYNDTRRKVVPPEEIAANREERRRLIASNVAGVNTPAIADLDAQYDQYRARNVAVMNAYVSWTRSALSDLPRWREPPQIYRGG
- Mass
- 19,855 Da
- Length
- 176 Aa
Rv3425 doesn't seem to be a targeted by any drug.
Rv3425 doesn't seem to be involved in any pathway.
- PPE57 induces activation of macrophages and drives Th1-type immune responses through TLR2.
- J Mol Med (Berl). 2015 Jun;93(6):645-62. doi: 10.1007/s00109-014-1243-1. Epub 2015 Jan 15.
- Mycobacterium tuberculosis region of difference (RD) 2 antigen Rv1985c and RD11 antigen Rv3425 have the promising potential to distinguish patients with active tuberculosis from M. bovis BCG-vaccinated individuals.
- Clin Vaccine Immunol. 2013 Jan;20(1):69-76. doi: 10.1128/CVI.00481-12. Epub 2012 Nov 7.
- Novel recombinant RD2- and RD11-encoded Mycobacterium tuberculosis antigens are potential candidates for diagnosis of tuberculosis infections in BCG-vaccinated individuals.
- Microbes Infect. 2009 Sep;11(10-11):876-85. doi: 10.1016/j.micinf.2009.05.008. Epub 2009 May 23.
- PPE protein (Rv3425) from DNA segment RD11 of Mycobacterium tuberculosis: a novel immunodominant antigen of Mycobacterium tuberculosis induces humoral and cellular immune responses in mice.
- Microbiol Immunol. 2008 Apr;52(4):224-30. doi: 10.1111/j.1348-0421.2008.00029.x.
- PPE protein (Rv3425) from DNA segment RD11 of Mycobacterium tuberculosis: a potential B-cell antigen used for serological diagnosis to distinguish vaccinated controls from tuberculosis patients.
- Clin Microbiol Infect. 2007 Feb;13(2):139-145. doi: 10.1111/j.1469-0691.2006.01561.x.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.