rplM
- Type
- protein_coding
- Name
- rplM
- Locus Name
-
Rv3443c
- Product
-
50S ribosomal protein L13 RplM
- Functional Category
-
Information pathways
- Location
- 3861947..3862390 (- strand)
- Gene Length
- 443 bp
- Nucleotides
-
GTGCCCACGTACGCGCCCAAGGCGGGTGACACCACGCGATCGTGGTACGTCATCGACGCCACGGACGTGGTGCTTGGCCGCCTTGCCGTCGCGGCGGCCAACCTGCTGCGCGGCAAGCACAAGCCGACGTTCGCCCCCAATGTCGATGGCGGTGACTTCGTCATCGTGATCAACGCCGACAAGGTCGCCATCAGCGGCGACAAACTGCAGCACAAGATGGTTTACCGGCACTCGGGGTATCCCGGCGGCCTGCACAAGCGCACCATCGGTGAGCTAATGCAACGCCACCCCGACCGCGTGGTGGAAAAGGCGATCCTCGGCATGTTGCCCAAGAACAGGCTCAGCCGCCAGATCCAGCGCAAGCTTCGCGTCTACGCCGGCCCGGAGCATCCGCACAGCGCTCAGCAGCCGGTTCCGTACGAGCTCAAGCAGGTGGCGCAATG
- Drug Resistance
- Mutations
- Function
- This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly. {ECO:0000255|HAMAP-Rule:MF_01366}.
- Family
-
Universal ribosomal protein uL13 family
- GO
-
- cytosolic large ribosomal subunit GO:0022625 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- mRNA binding GO:0003729 molecular_function
- negative regulation of translation GO:0017148 biological_process
- cell wall GO:0005618 cellular_component
- ribosome GO:0005840 cellular_component
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- translation GO:0006412 biological_process
- InterPro
5V7Q
- Name
- 50S ribosomal protein L13
- Family
- Universal ribosomal protein uL13 family
- Protein Sequence
-
MPTYAPKAGDTTRSWYVIDATDVVLGRLAVAAANLLRGKHKPTFAPNVDGGDFVIVINADKVAISGDKLQHKMVYRHSGYPGGLHKRTIGELMQRHPDRVVEKAILGMLPKNRLSRQIQRKLRVYAGPEHPHSAQQPVPYELKQVAQ
- Mass
- 16,337 Da
- Length
- 147 Aa
Summary
Rv3443c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.