rpsK
- Type
- protein_coding
- Name
- rpsK
- Locus Name
-
Rv3459c
- Product
-
30S ribosomal protein S11 RpsK
- Functional Category
-
Information pathways
- Location
- 3879273..3879692 (- strand)
- Gene Length
- 419 bp
- Nucleotides
-
ATGCCACCAGCAAAAAAAGGGCCGGCAACGTCGGCTAGGAAGGGCCAGAAGACCCGCCGGCGGGAGAAGAAGAACGTCCCGCACGGCGCCGCCCACATCAAGAGCACGTTCAACAACACGATCGTGACCATCACCGACCCGCAAGGCAACGTCATTGCCTGGGCATCGTCGGGGCACGTCGGCTTCAAGGGTTCCCGGAAATCGACCCCGTTTGCGGCCCAGCTGGCCGCGGAGAACGCCGCTCGCAAGGCCCAAGACCACGGGGTGCGCAAGGTCGACGTGTTCGTCAAGGGCCCGGGCTCGGGCCGCGAGACCGCGATCCGGTCGCTGCAGGCCGCCGGCCTGGAGGTGGGCGCGATCTCGGATGTCACCCCCCAGCCGCATAACGGTGTCCGGCCCCCCAAGCGCCGGCGCGTCTA
- Drug Resistance
- Mutations
- Function
- Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome. {ECO:0000255|HAMAP-Rule:MF_01310}.
- Family
-
Universal ribosomal protein uS11 family
- GO
-
- cytosolic small ribosomal subunit GO:0022627 cellular_component
- structural constituent of ribosome GO:0003735 molecular_function
- maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) GO:0000462 biological_process
- plasma membrane GO:0005886 cellular_component
- small ribosomal subunit rRNA binding GO:0070181 molecular_function
- ribosomal small subunit assembly GO:0000028 biological_process
- translation GO:0006412 biological_process
- mRNA 5'-UTR binding GO:0048027 molecular_function
- InterPro
Summary
- Name
- 30S ribosomal protein S11
- Family
- Universal ribosomal protein uS11 family
- Protein Sequence
-
MPPAKKGPATSARKGQKTRRREKKNVPHGAAHIKSTFNNTIVTITDPQGNVIAWASSGHVGFKGSRKSTPFAAQLAAENAARKAQDHGVRKVDVFVKGPGSGRETAIRSLQAAGLEVGAISDVTPQPHNGVRPPKRRRV
- Mass
- 14,785 Da
- Length
- 139 Aa
Rv3459c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.