rpsM
- Type
- protein_coding
- Name
- rpsM
- Locus Name
-
Rv3460c
- Product
-
30S ribosomal protein S13 RpsM
- Functional Category
-
Information pathways
- Location
- 3879696..3880070 (- strand)
- Gene Length
- 374 bp
- Nucleotides
-
ATGGCTCGACTCGTCGGCGTCGACCTGCCGCGCGATAAGCGGATGGAGGTCGCCCTGACCTACATCTTTGGCATCGGCCGTACCCGCTCGAACGAAATCCTGGCGGCCACCGGCATTGACCGGGATCTGCGCACCAGAGATCTCACCGAAGAACAGCTGATCCACCTGCGCGACTACATCGAAGCGAACCTGAAGGTGGAGGGTGACCTGCGCCGCGAGGTACAGGCCGACATCCGTCGCAAGATCGAGATTGGCTGCTATCAGGGGTTGCGGCACCGCCGCGGTATGCCGGTACGCGGCCAGCGGACAAAAACCAACGCGCGGACCCGCAAAGGCCCCAAGCGCACCATCGCAGGCAAGAAGAAGGCTAGGTA
- Drug Resistance
- Mutations
- Function
- Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites. {ECO:0000255|HAMAP-Rule:MF_01315}.
- Family
-
Universal ribosomal protein uS13 family
- GO
-
- structural constituent of ribosome GO:0003735 molecular_function
- rRNA binding GO:0019843 molecular_function
- ribosome GO:0005840 cellular_component
- tRNA binding GO:0000049 molecular_function
- translation GO:0006412 biological_process
- plasma membrane GO:0005886 cellular_component
- cytosol GO:0005829 cellular_component
- InterPro
Summary
- Name
- 30S ribosomal protein S13
- Family
- Universal ribosomal protein uS13 family
- Protein Sequence
-
MARLVGVDLPRDKRMEVALTYIFGIGRTRSNEILAATGIDRDLRTRDLTEEQLIHLRDYIEANLKVEGDLRREVQADIRRKIEIGCYQGLRHRRGMPVRGQRTKTNARTRKGPKRTIAGKKKAR
- Mass
- 14,351 Da
- Length
- 124 Aa
Rv3460c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.