rpmJ
- Type
- protein_coding
- Name
- rpmJ
- Locus Name
-
Rv3461c
- Product
-
50S ribosomal protein L36 RpmJ
- Functional Category
-
Information pathways
- Location
- 3880286..3880399 (- strand)
- Gene Length
- 113 bp
- Nucleotides
-
GTGAAGGTAAACCCGAGCGTCAAGCCGATCTGTGACAAGTGCAGGCTGATCCGTCGGCACGGGCGGGTTATGGTGATCTGTTCCGATCCGCGTCACAAACAAAGGCAGGGCTA
- Drug Resistance
- Mutations
- Function
- Unknown
- Family
-
Bacterial ribosomal protein bL36 family
- GO
-
- structural constituent of ribosome GO:0003735 molecular_function
- ribosome GO:0005840 cellular_component
- translation GO:0006412 biological_process
- InterPro
5V7Q
- Name
- 50S ribosomal protein L36 (Ribosomal protein B)
- Family
- Bacterial ribosomal protein bL36 family
- Protein Sequence
-
MKVNPSVKPICDKCRLIRRHGRVMVICSDPRHKQRQG
- Mass
- 4,343 Da
- Length
- 37 Aa
Summary
Rv3461c doesn't seem to be a targeted by any drug.
-
-
Ribosome mtu03010
mtu03010PATHWAY_MAP mtu03010 Ribosome
-
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.