infA
- Type
- protein_coding
- Name
- infA
- Locus Name
-
Rv3462c
- Product
-
Probable translation initiation factor if-1 InfA
- Functional Category
-
Information pathways
- Location
- 3880432..3880653 (- strand)
- Gene Length
- 221 bp
- Nucleotides
-
ATGGCCAAGAAGGACGGTGCCATAGAGGTCGAGGGTCGCGTGGTCGAGCCCCTGCCCAATGCCATGTTCCGCATTGAGCTGGAGAACGGCCACAAGGTGCTCGCCCACATCAGCGGCAAGATGCGTCAGCACTACATTCGCATCCTGCCCGAGGACCGGGTGGTGGTGGAATTGTCGCCCTACGACCTGTCCCGGGGCCGCATCGTGTACCGGTACAAGTA
- Drug Resistance
- Mutations
- Function
- One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection, yielding the 30S pre-initiation complex (PIC). Upon addition of the 50S ribosomal subunit IF-1, IF-2 and IF-3 are released leaving the mature 70S translation initiation complex. {ECO:0000255|HAMAP-Rule:MF_00075}.
- Family
-
IF-1 family
- GO
-
- translation initiation factor activity GO:0003743 molecular_function
- ribosome binding GO:0043022 molecular_function
- rRNA binding GO:0019843 molecular_function
- cell wall GO:0005618 cellular_component
- cytosol GO:0005829 cellular_component
- plasma membrane GO:0005886 cellular_component
- InterPro
3I4O
- Name
- Translation initiation factor IF-1
- Family
- IF-1 family
- Protein Sequence
-
MAKKDGAIEVEGRVVEPLPNAMFRIELENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK
- Mass
- 8,489 Da
- Length
- 73 Aa
Summary
Rv3462c doesn't seem to be a targeted by any drug.
Rv3462c doesn't seem to be involved in any pathway.
- Structure of translation initiation factor 1 from Mycobacterium tuberculosis and inferred binding to the 30S ribosomal subunit.
- FEBS Lett. 2010 Mar 5;584(5):1011-5. doi: 10.1016/j.febslet.2010.01.051. Epub 2010 Feb 2.
- Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.
- Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3.
- Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence.
- Nature. 1998 Jun 11;393(6685):537-44. doi: 10.1038/31159.